Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1317 bp · TkA01G594910|TK1151|cDNA
CCCTTTTGTTTTAACCCACGGTTGGATAGAAAACAAAAAAAGATTGATTTACATTAAAGTAAAGAGCAGGGACCACTCTAGAATTGATTTACACCATGAGAACTGATTGCTTTTATTGTGTGGAGGCACAGTAGCTCCGGAAAGGACGAAAATCAACAATGGAGGTAGTGTGCGTAACCGGCGGAAGTGGCTATATTGGCTCGTGGCTGGTCCGCCTCCTCCTTGATCGCGGCTACGCAGTCAACGCCACCGTCAAAGAT...
960 bp · TkA01G594910|TK1151|CDS
ATGGAGGTAGTGTGCGTAACCGGCGGAAGTGGCTATATTGGCTCGTGGCTGGTCCGCCTCCTCCTTGATCGCGGCTACGCAGTCAACGCCACCGTCAAAGATCTCAAAGACGAGAAGGAAACGAAGCATCTAGAAGCCTTAGAGGGAGCAGAATCACGTCTCCGCCTCTTCCAAATCGATCTCTTGGATTACGAATCAATTGTCGCCGCCGTCACCGGCGCATCCGGTGTCTTTCACTTGGCTTCGCCTTGCATCGTTGA...
Protein
Download Protein FASTA319 aa · TkA01G594910|TK1151|PROTEIN
MEVVCVTGGSGYIGSWLVRLLLDRGYAVNATVKDLKDEKETKHLEALEGAESRLRLFQIDLLDYESIVAAVTGASGVFHLASPCIVDKVHDPENELLAPAIKGTTNVLTAAKELGVKRVVVTSSVSAIVPSPKWPADVPKSEDCWTDEEYCKQKELWYPLSKTIAEKTAWEFAKEKGLDIVVVNPGTVMGPILPPTLNASMLMILRLIQGCTETYENFFMGSVHVKDVALAHILVYENKSAKGRHSCLEAISHYGDFAAM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G594910 |
|---|---|
| TK1151 ID | TkA01G594910 |
| OH-1004 ID | LXL04_009213 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 45.900 |
| Protein coverage (%) | TK1151 99.373 / OH-1004 93.134Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G594910 |
|---|---|
| Location | Chr01:149807535-149809815 (+) |
| Description | Similar to CCR1: Cinnamoyl-CoA reductase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007623 circadian rhythm Biological Process GO:0009409 response to cold Biological Process GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0010597 green leaf volatile biosynthetic process Biological Process GO:0042754 negative regulation of circadian rhythm Biological Process GO:0005737 cytoplasm Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0016621 cinnamoyl-CoA reductase activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G15950 ath:AT1G80820 mtr:11424763 mtr:25487973 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05368NmrA3-125 aaPF00106adh_short3-74 aaPF01370Epimerase4-241 aaPF02719Polysacc_synt_24-130 aaPF08659KR4-132 aaPF04321RmlD_sub_bind4-121 aaPF010733Beta_HSD6-238 aaPF16363GDP_Man_Dehyd6-192 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G594910 | PF05368 | NmrA | 3 | 125 | 2.6e-14 | 54.2 |
| TkA01G594910 | PF00106 | adh_short | 3 | 74 | 3.9e-06 | 27.2 |
| TkA01G594910 | PF01370 | Epimerase | 4 | 241 | 9.6e-29 | 101.2 |
| TkA01G594910 | PF02719 | Polysacc_synt_2 | 4 | 130 | 2.3e-09 | 37.6 |
| TkA01G594910 | PF08659 | KR | 4 | 132 | 9.5e-08 | 32.9 |
| TkA01G594910 | PF04321 | RmlD_sub_bind | 4 | 121 | 0.0081 | 16.0 |
| TkA01G594910 | PF01073 | 3Beta_HSD | 6 | 238 | 1.5e-23 | 84.0 |
| TkA01G594910 | PF16363 | GDP_Man_Dehyd | 6 | 192 | 1e-17 | 65.4 |
| TkA01G594910 | PF07993 | NAD_binding_4 | 6 | 204 | 5.1e-12 | 46.2 |
| TkA01G594910 | PF13460 | NAD_binding_10 | 8 | 188 | 5.2e-14 | 53.3 |
| TkA01G594910 | PF03435 | Sacchrp_dh_NADP | 9 | 81 | 0.023 | 15.8 |
| TkA01G594910 | PF00106 | adh_short | 100 | 135 | 3.9e-06 | 27.2 |
| TkA01G594910 | PF02719 | Polysacc_synt_2 | 160 | 190 | 2.3e-09 | 37.6 |
| TkA01G594910 | PF00106 | adh_short | 171 | 188 | 3.9e-06 | 27.2 |
| TkA01G594910 | PF03435 | Sacchrp_dh_NADP | 246 | 281 | 0.023 | 15.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.