TkA01G594660 | RubberDandelionOmics

Gene overview

TkA01G594660

Reference: TK1151 Chr: Chr01 Coordinates: 149734104-149737299 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1555 bp · TkA01G594660|TK1151|cDNA

ATCATATACAAACATCAATCCAAACGTTGGCAGTTGGCATGCTCTATAGCATTTCTAGTTACCCTTGTAATCTCCGCTGCAATTTCAAAACCCTCGTATAAATTCAAATTCATTACCACTGAATGCATGCTTGTTTCCCACCAATCTATCATCTGGTTCAGCATCTGGTTCAGCTTCCCTCGATTTCTCAGACCCTTTGGTAGTTTCAATCCTATCTTAACAATGGCTTCATCATCCCTTGTGCTTCCTTCGGTGTCGCT...

CDS

Download CDS FASTA

1362 bp · TkA01G594660|TK1151|CDS

ATCATATACAAACATCAATCCAAACGTTGGCAGTTGGCATGCTCTATAGCATTTCTAGTTACCCTTGTAATCTCCGCTGCAATTTCAAAACCCTCGTATAAATTCAAATTCATTACCACTGAATGCATGCTTGTTTCCCACCAATCTATCATCTGGTTCAGCATCTGGTTCAGCTTCCCTCGATTTCTCAGACCCTTTGGTAGTTTCAATCCTATCTTAACAATGGCTTCATCATCCCTTGTGCTTCCTTCGGTGTCGCT...

Protein

Download Protein FASTA

453 aa · TkA01G594660|TK1151|PROTEIN

IIYKHQSKRWQLACSIAFLVTLVISAAISKPSYKFKFITTECMLVSHQSIIWFSIWFSFPRFLRPFGSFNPILTMASSSLVLPSVSLNHKPSIDALEPFPLKSSSSLCFGGSKHGFRRLNLDKSRVSMSVSVGSTTTVADALFADYKPTTAFLFPGQGAQAVGMGQEAQKVPAAAELYNKANEILGFDILDVCINGPKEKLDSTVLSQATIYVSSLAAVEILRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G594660`
TK1151 ID	TkA01G594660
OH-1004 ID	LXL04_000676
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 86.745 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G594660`
Location	Chr01:149734104-149737299 (+)
Description	Similar to MCAT: Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000676` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0006635 fatty acid beta-oxidation Biological Process GO:0180026 mitochondrial small ribosomal subunit assembly Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0003723 RNA binding Molecular Function GO:0004314 [acyl-carrier-protein] S-malonyltransferase activity Molecular Function GO:0140691 RNA folding chaperone Molecular Function
KEGG gene cross-reference	bsu:BSU15900 dme:Dmel_CG7842 ecj:JW1078 eco:b1092 ecoc:C3026_06605 hsa:27349 mmu:223722 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA01G594660 · TK1151

Mitochondrion0.043

Rank 2 · TkA01G594660 · TK1151

Cytoplasm0.025

Rank 3 · TkA01G594660 · TK1151

Nucleus0.016

Rank 4 · TkA01G594660 · TK1151

Peroxisome0.016

Rank 5 · TkA01G594660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00698Acyl_transf_1152-421 aa

PF16073SAT255-355 aa

PF22690FAS_AT_central281-341 aa

PF01608I_LWEQ311-374 aa

PF22690FAS_AT_central393-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G594660	`PF00698`	Acyl_transf_1	152	421	1e-24	88.4
TkA01G594660	`PF16073`	SAT	255	355	0.028	14.7
TkA01G594660	`PF22690`	FAS_AT_central	281	341	0.21	12.4
TkA01G594660	`PF01608`	I_LWEQ	311	374	0.076	13.8
TkA01G594660	`PF22690`	FAS_AT_central	393	403	0.21	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card