TkA01G594370 | RubberDandelionOmics

Gene overview

TkA01G594370

Reference: TK1151 Chr: Chr01 Coordinates: 149678858-149679402 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · TkA01G594370|TK1151|cDNA

GCGATTGGAACTCCCCTCGATAGTAGTACCGCAAATGAGGTAGATTTCGCTGTTGCTCTACAAGCGTCTTCGTCTTCGACGCCGGTCAAGAATAAGGTTGCGTCTCCTAATCTAAAATTAGGGTTCACAAACGAAAAAGGAAAGGAGCTTTCCATCGACAATAAATTCACGAGTTATGATGACGATTTAGGTCTTAATTTCGATAATAATCACATTAGAGAACCCACTATGACTCCCTCCGATGATCGCAAAACTGGCAA...

CDS

Download CDS FASTA

507 bp · TkA01G594370|TK1151|CDS

GCGATTGGAACTCCCCTCGATAGTAGTACCGCAAATGAGGTAGATTTCGCTGTTGCTCTACAAGCGTCTTCGTCTTCGACGCCGGTCAAGAATAAGGTTGCGTCTCCTAATCTAAAATTAGGGTTCACAAACGAAAAAGGAAAGGAGCTTTCCATCGACAATAAATTCACGAGTTATGATGACGATTTAGGTCTTAATTTCGATAATAATCACATTAGAGAACCCACTATGACTCCCTCCGATGATCGCAAAACTGGCAA...

Protein

Download Protein FASTA

168 aa · TkA01G594370|TK1151|PROTEIN

AIGTPLDSSTANEVDFAVALQASSSSTPVKNKVASPNLKLGFTNEKGKELSIDNKFTSYDDDLGLNFDNNHIREPTMTPSDDRKTGKKQWGKDWWWKQDGTGFTIGDFVCEFGSRLFTEDAGVEAGYRRHCEDFERGNDLPVDPFEFSPSPPSKSVGRSKSKRKMSID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G594370`
TK1151 ID	TkA01G594370
OH-1004 ID	LXL04_000677
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.700
Protein coverage (%)	TK1151 82.143 / OH-1004 75.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G594370

Location Chr01:149678858-149679402 (+)

Description Similar to At1g80870: Putative receptor-like protein kinase At1g80870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80870`	Putative receptor-like protein kinase At1g80870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000677 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G80870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.796

Rank 1 · TkA01G594370 · TK1151

Cytoplasm0.255

Rank 2 · TkA01G594370 · TK1151

Cell membrane0.050

Rank 3 · TkA01G594370 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA01G594370 · TK1151

Mitochondrion0.028

Rank 5 · TkA01G594370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30188PF3D7_1446700_N29-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G594370	`PF30188`	PF3D7_1446700_N	29	74	0.11	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAH3`	Arabidopsis thaliana	sp\|Q9SAH3\|Y1887_ARATH Putative receptor-like protein kinase At1g80870	41.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card