TkA01G593650 | RubberDandelionOmics

Gene overview

TkA01G593650

Reference: TK1151 Chr: Chr01 Coordinates: 149473938-149477024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1941 bp · TkA01G593650|TK1151|cDNA

AAACAACATGCATACCAAAAATGGTGGTGGCATTCCATTAAACCACATATTATAAACATCACTTCATATGTCTATATTTACACACACATGAACACACACACTGCTATCCCATCAAAATCTTGAAAATATCCCTAATTTTCAAGAAAAACCTCTCAAATCTCAATGGCTCATCAATGGCTTAGCCTAGTTGGTACAATTTGGCTTCAATCCATAAGTGCAACAAACTCAAACTTCCCATCATACTCTTCCCAACTCAAACA...

CDS

Download CDS FASTA

1545 bp · TkA01G593650|TK1151|CDS

ATGGCTCATCAATGGCTTAGCCTAGTTGGTACAATTTGGCTTCAATCCATAAGTGCAACAAACTCAAACTTCCCATCATACTCTTCCCAACTCAAACAGCTTCTTTCTCTCTCACAACTTCAACTCAACAATTTAGCTTTTGCCTCCGATGCCGGAAAACTCTTTGGTTTCATCTCCGGCATGGCGGCCGTTTATCTCCCTCTTTGGCTCGTTCTCTTAATCGGTTCTTCAATTGGGTTCATTGGCTATGGCGTCCAGTA...

Protein

Download Protein FASTA

514 aa · TkA01G593650|TK1151|PROTEIN

MAHQWLSLVGTIWLQSISATNSNFPSYSSQLKQLLSLSQLQLNNLAFASDAGKLFGFISGMAAVYLPLWLVLLIGSSIGFIGYGVQYLFLVTNQVSSLPYTLLFLLTVLAGNSICWINTVCYVIAIQNFPLDRQLAVGLSTSYQGLSAKIYSDVVDVVFKSSSLTSIQTARSYLLLNCILPLLVCLIASPFIRVITTGRSKRLSRGFLVIFTITLFTGTYAVITSIESRKRICPPLVILVGMCVFLVAPLVVPLVEKLRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593650`
TK1151 ID	TkA01G593650
OH-1004 ID	LXL04_000689
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G593650

Location Chr01:149473938-149477024 (-)

Description Similar to NFD4: Protein NUCLEAR FUSION DEFECTIVE 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31470`	Required for karyogamy during female gametophyte development, when the two polar nuclei fuse to form the diploid central cell nucleus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000689 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.514

Rank 1 · TkA01G593650 · TK1151

Cell membrane0.190

Rank 2 · TkA01G593650 · TK1151

Endoplasmic reticulum0.151

Rank 3 · TkA01G593650 · TK1151

Cytoplasm0.129

Rank 4 · TkA01G593650 · TK1151

Golgi apparatus0.116

Rank 5 · TkA01G593650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06813Nodulin-like4-254 aa

PF07690MFS_124-147 aa

PF07690MFS_1175-257 aa

PF07235DUF1427222-265 aa

PF23262NFD4_C305-513 aa

PF06813Nodulin-like313-373 aa

PF07690MFS_1322-509 aa

PF06813Nodulin-like398-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593650	`PF06813`	Nodulin-like	4	254	2.2e-69	234.5
TkA01G593650	`PF07690`	MFS_1	24	147	0.026	14.1
TkA01G593650	`PF07690`	MFS_1	175	257	0.026	14.1
TkA01G593650	`PF07235`	DUF1427	222	265	0.027	15.1
TkA01G593650	`PF23262`	NFD4_C	305	513	2.1e-90	303.0
TkA01G593650	`PF06813`	Nodulin-like	313	373	2.2e-69	234.5
TkA01G593650	`PF07690`	MFS_1	322	509	0.026	14.1
TkA01G593650	`PF06813`	Nodulin-like	398	450	2.2e-69	234.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9E1`	Arabidopsis thaliana	sp\|F4I9E1\|NFD4_ARATH Protein NUCLEAR FUSION DEFECTIVE 4	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card