TkA01G593120 | RubberDandelionOmics

Gene overview

TkA01G593120

Reference: TK1151 Chr: Chr01 Coordinates: 149311624-149313574 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · TkA01G593120|TK1151|cDNA

TCAAAAGTCAAAAATCCTAACGGTCAGATTTTATAAGACTGACGTTGGGTCACTGGGTGAGTGAAGAGAACGTTAGCGGAGAAAATGGGGAAACGAAAGGGGCGTCAATCACAGTCAGAGAACACAGACATCCTAAATCACTCTAATGGAGGAGAAGATGAATCCAGAAATGGACGATCAGATGATTTAGAAGAAGGCGAGAAATCAGGGTTCTTCGCTTGCTATTTGTTGACGTCACTTTGCCCTAGATACAAAGGACA...

CDS

Download CDS FASTA

1026 bp · TkA01G593120|TK1151|CDS

ATGGGGAAACGAAAGGGGCGTCAATCACAGTCAGAGAACACAGACATCCTAAATCACTCTAATGGAGGAGAAGATGAATCCAGAAATGGACGATCAGATGATTTAGAAGAAGGCGAGAAATCAGGGTTCTTCGCTTGCTATTTGTTGACGTCACTTTGCCCTAGATACAAAGGACACACCTACATCGGGTTCACTGTGAACCCAAGGCGGCGAATTAGGCAACACAATGGGGAATTATGCAGCGGTGCATTCAGGACCAA...

Protein

Download Protein FASTA

341 aa · TkA01G593120|TK1151|PROTEIN

MGKRKGRQSQSENTDILNHSNGGEDESRNGRSDDLEEGEKSGFFACYLLTSLCPRYKGHTYIGFTVNPRRRIRQHNGELCSGAFRTKKKRPWEMVLCIYGFPTNVAALQFEWAWQHPVESLAVRKAAVGFKSLGGLANKIKLAYTMLTLPTWNNLNLNVNFFSTKYTKHYAGCPTLPTHMRVHIRSMDELPCYTEGFKEQEEDDMFGFGNNFHDDDDDMNKEQEEEEEEEEPTSVSDTENLQEPVLVFSDHQNNEEKANC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593120`
TK1151 ID	TkA01G593120
OH-1004 ID	LXL04_000696
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G593120`
Location	Chr01:149311624-149313574 (+)
Description	Similar to Slx1b: Structure-specific endonuclease subunit SLX1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000696` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing Biological Process GO:0010833 telomere maintenance via telomere lengthening Biological Process GO:0032204 regulation of telomere maintenance Biological Process GO:0061820 telomeric D-loop disassembly Biological Process GO:0090656 t-circle formation Biological Process GO:1904357 negative regulation of telomere maintenance via telomere lengthening Biological Process GO:1904431 positive regulation of t-circle formation Biological Process GO:0000228 nuclear chromosome Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	bta:510858 hsa:548593 hsa:79008 mmu:75764 nve:5504005 rno:293489 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.918

Rank 1 · TkA01G593120 · TK1151

Cytoplasm0.192

Rank 2 · TkA01G593120 · TK1151

Mitochondrion0.028

Rank 3 · TkA01G593120 · TK1151

Cell membrane0.020

Rank 4 · TkA01G593120 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA01G593120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01541GIY-YIG46-117 aa

PF10544T5orf17253-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593120	`PF01541`	GIY-YIG	46	117	2.3e-13	51.0
TkA01G593120	`PF10544`	T5orf172	53	95	0.17	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card