TkA01G590090 | RubberDandelionOmics

Gene overview

TkA01G590090

Reference: TK1151 Chr: Chr01 Coordinates: 148462708-148466340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · TkA01G590090|TK1151|cDNA

CCAACATTCACACCCGCCACAGATTACGCGTTTCGTTTGGCCCACATTTATAGTTGCCATTTCCATTTGGTACTTAACTCACCTGCTTCTACTTCTCTACACCCTTCATCTCCCGTAACCCCTAATCATACTCAAATCAACTCTGCATCCAGTCTTCGATCAACAGCTACTCCATAAATAAGCAAGAATCCTTTCGAAACTTGACAAACCCTCTACTGAAAATGGTGTTTCAGTAAGAAAGGTAGTTTTACTGTGCTTAA...

CDS

Download CDS FASTA

1161 bp · TkA01G590090|TK1151|CDS

ATGGCGGGTGGTGAAGGAGAAGGGACGTCGTTAGAATTTACACCCACATGGGTTGTCGCCGCCGTGTGTACCCTCATCGTCGGAATCTCCCTCGCCGTCGAACGTCTACTCCATTACGCCGGCAAGAAATTGAAGAAGGCAGGTCAAAAGCCACTTTATGAAGCCCTTCAAAAGATCAAAGAAGAGCTGATGCTGTTGGGGTTTATTTCGCTTCTATTGACGGTGTTCCAGTCTAGAATCATCAGAATATGCGTAAAGCA...

Protein

Download Protein FASTA

386 aa · TkA01G590090|TK1151|PROTEIN

MAGGEGEGTSLEFTPTWVVAAVCTLIVGISLAVERLLHYAGKKLKKAGQKPLYEALQKIKEELMLLGFISLLLTVFQSRIIRICVKQSIMNHLLPCSLGDREKAIGPKPESEITSHLLRHLLAEEESSTGYCAKKGKVPLLSLEALHHLHIFIFVLAVVHVTFSVLTVVFGSGRIRQWKHWEDSIAKDNFDASKVFKPRVTHVKDHDFIRNRFVGIGKGSAIRGWLHSFFKQFYGSVTKSDYVALRLGFITTHCKANPKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G590090`
TK1151 ID	TkA01G590090
OH-1004 ID	LXL04_000753
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.446 / OH-1004 76.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G590090

Location Chr01:148462708-148466340 (-)

Description Similar to MLO1: MLO-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02600`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g44110`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At4g24250`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0486300`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000753 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G61560

ath:AT2G33670

ath:AT2G44110

ath:AT4G02600

ath:AT4G24250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.757

Rank 1 · TkA01G590090 · TK1151

Endoplasmic reticulum0.141

Rank 2 · TkA01G590090 · TK1151

Cytoplasm0.128

Rank 3 · TkA01G590090 · TK1151

Lysosome / Vacuole0.073

Rank 4 · TkA01G590090 · TK1151

Golgi apparatus0.070

Rank 5 · TkA01G590090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo9-381 aa

PF09221Bacteriocin_IId16-50 aa

PF24195DUF742018-54 aa

PF17818KCT2146-179 aa

PF24195DUF7420149-169 aa

PF09221Bacteriocin_IId160-175 aa

PF09221Bacteriocin_IId280-308 aa

PF24195DUF7420284-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G590090	`PF03094`	Mlo	9	381	8.4e-153	509.9
TkA01G590090	`PF09221`	Bacteriocin_IId	16	50	2.4	9.2
TkA01G590090	`PF24195`	DUF7420	18	54	7.1	7.5
TkA01G590090	`PF17818`	KCT2	146	179	3.4	8.5
TkA01G590090	`PF24195`	DUF7420	149	169	7.1	7.5
TkA01G590090	`PF09221`	Bacteriocin_IId	160	175	2.4	9.2
TkA01G590090	`PF09221`	Bacteriocin_IId	280	308	2.4	9.2
TkA01G590090	`PF24195`	DUF7420	284	318	7.1	7.5
TkA01G590090	`PF17818`	KCT2	344	365	3.4	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49621`	Arabidopsis thaliana	sp\|O49621\|MLO1_ARATH MLO-like protein 1	71.900%	Swiss-Prot	High
`O80580`	Arabidopsis thaliana	sp\|O80580\|MLO15_ARATH MLO-like protein 15	63.000%	Swiss-Prot	High
`Q94KB2`	Arabidopsis thaliana	sp\|Q94KB2\|MLO13_ARATH MLO-like protein 13	56.800%	Swiss-Prot	High
`O22815`	Arabidopsis thaliana	sp\|O22815\|MLO5_ARATH MLO-like protein 5	46.600%	Swiss-Prot	Medium
`Q0DC45`	Oryza sativa subsp. japonica	sp\|Q0DC45\|MLOH1_ORYSJ MLO protein homolog 1	45.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card