TkA01G589520 | RubberDandelionOmics

Gene overview

TkA01G589520

Reference: TK1151 Chr: Chr01 Coordinates: 148305843-148307753 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA01G589520|TK1151|cDNA

ATGTGTCTTTCCATACTTATCATATCCATCACATACACCAACGCGGTTCAAAGTGACATCGATTGTTTAAGATCCATCAAATCATCACTCAAAGACCCCGAAAACCTTCTATCATCATGGAATTTCAATAACAACACCGAAGGCTTCATTTGCAGATTCACAGGAATCGAATGCTGGCATCCTGATGAAAGCAAAGTCCTAAACATTCATCTTTCCGACATGGGATTGACAGTTCTTAAACTCGATAACAACCGGTTCTC...

CDS

Download CDS FASTA

1623 bp · TkA01G589520|TK1151|CDS

ATGTGTCTTTCCATACTTATCATATCCATCACATACACCAACGCGGTTCAAAGTGACATCGATTGTTTAAGATCCATCAAATCATCACTCAAAGACCCCGAAAACCTTCTATCATCATGGAATTTCAATAACAACACCGAAGGCTTCATTTGCAGATTCACAGGAATCGAATGCTGGCATCCTGATGAAAGCAAAGTCCTAAACATTCATCTTTCCGACATGGGATTGACAGTTCTTAAACTCGATAACAACCGGTTCTC...

Protein

Download Protein FASTA

540 aa · TkA01G589520|TK1151|PROTEIN

MCLSILIISITYTNAVQSDIDCLRSIKSSLKDPENLLSSWNFNNNTEGFICRFTGIECWHPDESKVLNIHLSDMGLTVLKLDNNRFSGQIPFELGGLNRIKEFSVANNLLSGPVPNFGQNHTINADSYAGNPGLCGKPLPLCEGKEKKTSSGVIIGAAIGGITVALLLAVASTMFIKKKVIRRKEEDPDENKWARSIKGTKTIKLSMFENPVSKMRLSDLMKATNNFSKDNIIGSGRTGSLYKATLEDGSSLMIKRLQDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G589520`
TK1151 ID	TkA01G589520
OH-1004 ID	LXL04_036691
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.000
Protein coverage (%)	TK1151 98.333 / OH-1004 96.895 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G589520

Location Chr01:148305843-148307753 (+)

Description Similar to At5g48380: Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48380`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380.	No verified direct reference in this release
`At3g28450`	Pseudokinases lacking protein kinase activity and unable to bind ATP-analogs.	Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005
`At1g69990`	Probable LRR receptor-like serine/threonine-protein kinase At1g69990.	No verified direct reference in this release
`At1g27190`	Probable inactive receptor kinase At1g27190.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036691 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G27190

ath:AT1G69990

ath:AT3G28450

ath:AT5G48380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.878

Rank 1 · TkA01G589520 · TK1151

Cytoplasm0.083

Rank 2 · TkA01G589520 · TK1151

Endoplasmic reticulum0.069

Rank 3 · TkA01G589520 · TK1151

Nucleus0.058

Rank 4 · TkA01G589520 · TK1151

Golgi apparatus0.018

Rank 5 · TkA01G589520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_217-59 aa

PF00560LRR_176-97 aa

PF00560LRR_1100-117 aa

PF00069Pkinase228-457 aa

PF07714PK_Tyr_Ser-Thr230-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G589520	`PF08263`	LRRNT_2	17	59	2.7e-09	37.9
TkA01G589520	`PF00560`	LRR_1	76	97	0.0027	18.2
TkA01G589520	`PF00560`	LRR_1	100	117	0.0027	18.2
TkA01G589520	`PF00069`	Pkinase	228	457	2.1e-33	116.6
TkA01G589520	`PF07714`	PK_Tyr_Ser-Thr	230	436	9.3e-39	134.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS4`	Arabidopsis thaliana	sp\|Q9ASS4\|Y5838_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380	53.300%	Swiss-Prot	High
`Q9LSI9`	Arabidopsis thaliana	sp\|Q9LSI9\|BIR2_ARATH Inactive LRR receptor-like serine/threonine-protein kinase BIR2	39.200%	Swiss-Prot	Medium
`C0LGI5`	Arabidopsis thaliana	sp\|C0LGI5\|Y1699_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g69990	36.900%	Swiss-Prot	Medium
`O04567`	Arabidopsis thaliana	sp\|O04567\|Y1719_ARATH Probable inactive receptor kinase At1g27190	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card