TkA01G589300 | RubberDandelionOmics

Gene overview

TkA01G589300

Reference: TK1151 Chr: Chr01 Coordinates: 148237335-148248352 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1808 bp · TkA01G589300|TK1151|cDNA

CTTTAAAACTGTAGTTTTCAACTTGGTTCCTAAAAAGAAGGGGGTTGCCTTTGTGTGAATAGAGAAAGTTGTCACAAAACTTCAAAACGGATTCAAGAATCTTTCATTCCCCCTTTTCTCTGTCTTGAATTGAAACCCCCAAATTTTTATATTAACATGATTAGTATAATGAACGCAGTCTATCTATTCTTATCAATTTATCTCTCATTTACCAATTTATTGGTACAATCCGCCCCTCAGAATGCCATAGTTTCCCAACT...

CDS

Download CDS FASTA

1479 bp · TkA01G589300|TK1151|CDS

ATGATTAGTATAATGAACGCAGTCTATCTATTCTTATCAATTTATCTCTCATTTACCAATTTATTGGTACAATCCGCCCCTCAGAATGCCATAGTTTCCCAACTTCCTGGATTTACTGGCACTATACCCTCCAAACACTATGCTGGGTATGTGACATTAGATAAAAACCATGGCAAGAAATTGTATTATTATTATGTGCTTTCAGAAAGAGACCCTTCTAAAGATCCGGTGGTTCTTTGGCTCAATGGTGGCCCTGGTTG...

Protein

Download Protein FASTA

492 aa · TkA01G589300|TK1151|PROTEIN

MISIMNAVYLFLSIYLSFTNLLVQSAPQNAIVSQLPGFTGTIPSKHYAGYVTLDKNHGKKLYYYYVLSERDPSKDPVVLWLNGGPGCSSFDGFVFEQGPFNFEKTGSMPKLHLNPYAWNKVSNMIFLDAPAGVGMSYSKNKSDYITSDTITAKDSHKFLLRWFKLYPEYLSNPFYIAGESFAGIYIPTLSNQVIKGINNGEKPTLNFKGYIIGNGVCDVVFDGNAFVPFARGMGLISEYMYQDTKKECNGTFYKPPTLKC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G589300`
TK1151 ID	TkA01G589300
OH-1004 ID	LXL04_000774
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 95.528 / OH-1004 36.892 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G589300

Location Chr01:148237335-148248352 (+)

Description Similar to CBP1: Serine carboxypeptidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12910`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g25420`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g22920`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g09640`	Involved in plants secondary metabolism.	The sng2 mutant of Arabidopsis is defective in the gene encoding the serine carboxypeptidase-like protein sinapoylglucose:choline sinapoyltransferase.2001 · DOI: 10.1046/j.1365-313x.2001.01123.x Benzoylation and sinapoylation of glucosinolate R-groups in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05096.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0257000`	Serine carboxypeptidase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000774 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

dosa:Os12g0257000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.425

Rank 1 · TkA01G589300 · TK1151

Extracellular0.315

Rank 2 · TkA01G589300 · TK1151

Cytoplasm0.090

Rank 3 · TkA01G589300 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA01G589300 · TK1151

Cell membrane0.079

Rank 5 · TkA01G589300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1036-489 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G589300	`PF00450`	Peptidase_S10	36	489	6e-138	461.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7B2`	Arabidopsis thaliana	sp\|Q8L7B2\|SCP20_ARATH Serine carboxypeptidase-like 20	60.900%	Swiss-Prot	High
`Q9LSV8`	Arabidopsis thaliana	sp\|Q9LSV8\|SCP21_ARATH Serine carboxypeptidase-like 21	59.800%	Swiss-Prot	High
`O81009`	Arabidopsis thaliana	sp\|O81009\|SCP12_ARATH Serine carboxypeptidase-like 12	37.000%	Swiss-Prot	Medium
`Q8VZU3`	Arabidopsis thaliana	sp\|Q8VZU3\|SCP19_ARATH Serine carboxypeptidase-like 19	38.500%	Swiss-Prot	Medium
`P37890`	Oryza sativa subsp. japonica	sp\|P37890\|CBP1_ORYSJ Serine carboxypeptidase 1	62.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card