TkA01G585210 | RubberDandelionOmics

Gene overview

TkA01G585210

Reference: TK1151 Chr: Chr01 Coordinates: 147168821-147172905 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3151 bp · TkA01G585210|TK1151|cDNA

ATTAAACTTCGGAACGGGTATAAAATAGATAATTAATTTAAACTTTTAACAAACTGATACCTTAACTCCGTTTGCACCCACCCTAGTCTCATTATCAATTATAAAAATGTTTTACAGTTCCTTTTGTTTTCACCATGAAAAATGAGGTAATTAACTTCTCAACATTAGTTAGGAGATGAAGGGAGGCAAGTGCAATGGAAGCCTCTCGTCCTCCTCCTCCTCCTAATAATATTAATAATTAATTAATGCTCCAGCCAGCT...

CDS

Download CDS FASTA

2097 bp · TkA01G585210|TK1151|CDS

ATGGAAGAGACATTTGCGCCTTTTCAAGGTATCAAGAACGACATCGATGGGCGATTGACGTGTTACAAGCAAGATTGGACAGGCGGCTTCCGTGCAGGCTTCAGAATTTTGGCTCCCACCACATATATATTCTTCGCCTCCGCAATCCCAGTTATATCGTTTGGCGAACAACTGGACAGAAATACGGAAGGAGCTCTGACGGCGGTTCAAACATTGGCGTCCACGGCAATATGTGGGATCATACACTCGTTGATTGGAGG...

Protein

Download Protein FASTA

698 aa · TkA01G585210|TK1151|PROTEIN

MEETFAPFQGIKNDIDGRLTCYKQDWTGGFRAGFRILAPTTYIFFASAIPVISFGEQLDRNTEGALTAVQTLASTAICGIIHSLIGGQPLLILGVAEPTVLMYTFMYNFAKQRPELGHNLFLAWSGWVCVWTAALLFLLAILGACSIINRFTRVAGELFGLLIAMLFMQQAIRGLVDEFRIPERANLKSVEFIPSWRFANGMFALVLAFGLLLTGLKSRKARSWRYGSGWIRSLIADYGVPLMVLVWTAVSYAPGASVPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G585210`
TK1151 ID	TkA01G585210
OH-1004 ID	LXL04_037130
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G585210

Location Chr01:147168821-147172905 (-)

Description Similar to BOR1: Boron transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47160`	Efflux-type boron (B) transporter for xylem loading, responsive of boron translocation from roots to shoots under boron limitation.	Arabidopsis boron transporter for xylem loading.2002 · DOI: 10.1038/nature01139 Improvement of seed yields under boron-limiting conditions through overexpression of BOR1, a boron transporter for xylem loading, in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02763.x DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.2016 · DOI: 10.1093/pcp/pcw121 bor1-1, an Arabidopsis thaliana mutant that requires a high level of boron.1997 · DOI: 10.1104/pp.115.3.901
`At3g62270`	Probable boron transporter.	No verified direct reference in this release
`At3g06450`	Probable boron transporter.	No verified direct reference in this release
`At1g15460`	Efflux-type boron transporter polarly localized in roots.	Plants tolerant of high boron levels.2007 · DOI: 10.1126/science.1146634
`At1g74810`	Putative boron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037130 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0010036 response to boron-containing substance Biological Process

GO:0035445 borate transmembrane transport Biological Process

GO:0046713 borate transport Biological Process

GO:0048364 root development Biological Process

GO:0050801 monoatomic ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080029 cellular response to boron-containing substance levels Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G15460

ath:AT1G74810

ath:AT2G47160

ath:AT3G06450

ath:AT3G62270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.513

Rank 1 · TkA01G585210 · TK1151

Endoplasmic reticulum0.182

Rank 2 · TkA01G585210 · TK1151

Cytoplasm0.141

Rank 3 · TkA01G585210 · TK1151

Lysosome / Vacuole0.121

Rank 4 · TkA01G585210 · TK1151

Golgi apparatus0.113

Rank 5 · TkA01G585210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00955HCO3_cotransp7-180 aa

PF07835COX4_pro_2119-141 aa

PF00955HCO3_cotransp201-372 aa

PF28326Sensor_actino362-417 aa

PF00955HCO3_cotransp463-605 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G585210	`PF00955`	HCO3_cotransp	7	180	4e-92	310.4
TkA01G585210	`PF07835`	COX4_pro_2	119	141	0.4	11.6
TkA01G585210	`PF00955`	HCO3_cotransp	201	372	4e-92	310.4
TkA01G585210	`PF28326`	Sensor_actino	362	417	0.36	11.8
TkA01G585210	`PF00955`	HCO3_cotransp	463	605	4e-92	310.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYR7`	Arabidopsis thaliana	sp\|Q8VYR7\|BOR1_ARATH Boron transporter 1	76.600%	Swiss-Prot	High
`Q9M1P7`	Arabidopsis thaliana	sp\|Q9M1P7\|BOR2_ARATH Probable boron transporter 2	74.800%	Swiss-Prot	High
`Q93Z13`	Arabidopsis thaliana	sp\|Q93Z13\|BOR3_ARATH Probable boron transporter 3	68.600%	Swiss-Prot	High
`Q9XI23`	Arabidopsis thaliana	sp\|Q9XI23\|BOR4_ARATH Boron transporter 4	58.700%	Swiss-Prot	High
`Q9SSG5`	Arabidopsis thaliana	sp\|Q9SSG5\|BOR5_ARATH Putative boron transporter 5	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card