RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G578970
Reference: TK1151 Chr: Chr01 Coordinates: 145623509-145624529 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

819 bp · TkA01G578970|TK1151|cDNA

ATGCTTGTTGTGGCCACCGGAGAAAACGCGGAAGGCGTAATACCGGAAATCGAAGGCCTAAAAGACTTCTCTGGTGAAGTGATCCATGCAAAAGACTACAAGTCCGGCGAGAAATACCAAGGAAAAAAAGTTTTAGTCGTCGGTTGTGGGAATTCCGGCATGGAAGTCTCTCTTGATCTCTCCAACCACGACGCAAAGCCATCAATGGTGATTCGTAACTCGGTTCATGTTCTACCAAGAGAAATGTTCGGAAAATCGAC...

CDS

Download CDS FASTA

819 bp · TkA01G578970|TK1151|CDS

ATGCTTGTTGTGGCCACCGGAGAAAACGCGGAAGGCGTAATACCGGAAATCGAAGGCCTAAAAGACTTCTCTGGTGAAGTGATCCATGCAAAAGACTACAAGTCCGGCGAGAAATACCAAGGAAAAAAAGTTTTAGTCGTCGGTTGTGGGAATTCCGGCATGGAAGTCTCTCTTGATCTCTCCAACCACGACGCAAAGCCATCAATGGTGATTCGTAACTCGGTTCATGTTCTACCAAGAGAAATGTTCGGAAAATCGAC...

Protein

Download Protein FASTA

272 aa · TkA01G578970|TK1151|PROTEIN

MLVVATGENAEGVIPEIEGLKDFSGEVIHAKDYKSGEKYQGKKVLVVGCGNSGMEVSLDLSNHDAKPSMVIRNSVHVLPREMFGKSTFDLAMMLMKWLPLWIVDKLLLLFAWFIIGNIQSYGIKRPSLGPLTLKNHHGKTPVLDIGALEKIRSGDITIVPGIKKFTGKSVELVNGESLNIDSVILATGYFSNVPFWLHETEFFAENGFPKTPFPNGWKGKGGLYAAGFTRRGLAGATADAMKISKDIGKEWKEELKQKKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G578970
TK1151 IDTkA01G578970
OH-1004 IDLXL04_000882
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 43.106
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G578970
LocationChr01:145623509-145624529 (+)
DescriptionSimilar to YUC8: Probable indole-3-pyruvate monooxygenase YUCCA8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g43890 Involved in auxin biosynthesis.
Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495
At1g04180 Involved in auxin biosynthesis. No verified direct reference in this release
At4g28720 Involved in auxin biosynthesis. No verified direct reference in this release
At1g04610 Involved in auxin biosynthesis. No verified direct reference in this release
At2g33230 Involved in auxin biosynthesis.
Activation of a flavin monooxygenase gene YUCCA7 enhances drought resistance in Arabidopsis.2012 · DOI: 10.1007/s00425-011-1552-3

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009635 response to herbicide Biological Process
GO:0009684 indoleacetic acid biosynthetic process Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009851 auxin biosynthetic process Biological Process
GO:0010262 somatic embryogenesis Biological Process
GO:0010600 regulation of auxin biosynthetic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0004497 monooxygenase activity Molecular Function
GO:0004499 N,N-dimethylaniline monooxygenase activity Molecular Function
KEGG gene cross-reference
ath:AT1G04180
ath:AT1G04610
ath:AT2G33230
ath:AT4G28720
ath:AT5G43890
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.386
Rank 1 · TkA01G578970 · TK1151
Cytoplasm0.245
Rank 2 · TkA01G578970 · TK1151
Mitochondrion0.196
Rank 3 · TkA01G578970 · TK1151
Cell membrane0.095
Rank 4 · TkA01G578970 · TK1151
Nucleus0.093
Rank 5 · TkA01G578970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13738Pyr_redox_32-74 aa
PF07992Pyr_redox_22-81 aa
PF13434Lys_Orn_oxgnase2-68 aa
PF00743FMO-like4-196 aa
PF00070Pyr_redox43-74 aa
PF01134GIDA43-73 aa
PF07992Pyr_redox_2156-194 aa
PF00070Pyr_redox163-177 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G578970PF13738Pyr_redox_32743.2e-1143.8
TkA01G578970PF07992Pyr_redox_22813.5e-1040.5
TkA01G578970PF13434Lys_Orn_oxgnase2683.3e-0730.5
TkA01G578970PF00743FMO-like41968.3e-2071.4
TkA01G578970PF00070Pyr_redox43740.007417.5
TkA01G578970PF01134GIDA43730.03114.1
TkA01G578970PF07992Pyr_redox_21561943.5e-1040.5
TkA01G578970PF00070Pyr_redox1631770.007417.5
TkA01G578970PF01134GIDA1682010.03114.1
TkA01G578970PF13738Pyr_redox_31691953.2e-1143.8
TkA01G578970PF13434Lys_Orn_oxgnase1761893.3e-0730.5
TkA01G578970PF00070Pyr_redox2442630.007417.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LKC0Arabidopsis thalianasp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA567.500%Swiss-ProtHigh
O64489Arabidopsis thalianasp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA968.300%Swiss-ProtHigh
Q9SVU0Arabidopsis thalianasp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA868.600%Swiss-ProtHigh
O23024Arabidopsis thalianasp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA366.500%Swiss-ProtHigh
O49312Arabidopsis thalianasp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA766.200%Swiss-ProtHigh

JBrowse

View in Genome Browser