TkA01G578820 | RubberDandelionOmics

Gene overview

TkA01G578820

Reference: TK1151 Chr: Chr01 Coordinates: 145562928-145566610 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2024 bp · TkA01G578820|TK1151|cDNA

TTACAATCAACCGAGCTTATTTAAATATATTTTACAAAAAAGTTATTTTTATAACTACATAGACTAATAAACATTTTTATAAAAAAAACAATAAATCCCAAATACTCCTTTGGTCCCTCTTTCTCTCTCAATTCTCAATAGGATGTTTACCGACCGTCACCATCCCCAAGGCGACATCCTGTCACTCACCAACAATGTCACCGTCTCCAACCACCGCAATCGATCAACAATGTTGGCCTTTTTCCGGCGTCCTCAATCTT...

CDS

Download CDS FASTA

1707 bp · TkA01G578820|TK1151|CDS

ATGGCAACTGCTGCGACTATATGGAATGTTGTGTCAAGAACCTCTGCTACCAAAAATGGAGCGACAATAGCTACCAACAGAAGAGAAGTTACAGCAAGTGGTTTAAGAGTTATGAAGAGGCATCCGGTCCTTGATGAAGGACTTAGGGTTTTTTACAACCCAAGAGTGACTGGACCAAGAACGATTCAAAATGTGAAGTCGAGAAAAGTTATGGTATGTGAATGTGGGATGAATTTGGTATTTGTGGGAGCAGAAGTAGG...

Protein

Download Protein FASTA

568 aa · TkA01G578820|TK1151|PROTEIN

MATAATIWNVVSRTSATKNGATIATNRREVTASGLRVMKRHPVLDEGLRVFYNPRVTGPRTIQNVKSRKVMVCECGMNLVFVGAEVGPWSKTGGLGDVLGGLPPAMAANGHRVMTVSPRYDQYKDAWDTEIELELKAGDRIEKVRFFHCYKRGVDRVFVDHPMFLEKVWGKTASKIYGPIAGIDYQDNQIRFSLLCQAALEAPRVLNLNSSKYFSGPYGEDVVFVANDWHSALIPCYLKSMYQSRGMYSSAKVAYCIHNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578820`
TK1151 ID	TkA01G578820
OH-1004 ID	LXL04_013368
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	43.400
Protein coverage (%)	TK1151 76.056 / OH-1004 57.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G578820

Location Chr01:145562928-145566610 (+)

Description Similar to Granule-bound starch synthase 2, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32900`	Required for the synthesis of amylose.	PROTEIN TARGETING TO STARCH is required for localising GRANULE-BOUND STARCH SYNTHASE to starch granules and for normal amylose synthesis in Arabidopsis.2015 · DOI: 10.1371/journal.pbio.1002080

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010021 amylopectin biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity Molecular Function

GO:0009011 alpha-1,4-glucan glucosyltransferase (ADP-glucose donor) activity Molecular Function

KEGG gene cross-reference

ath:AT3G01180

dosa:Os10g0437600

sot:102583115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.891

Rank 1 · TkA01G578820 · TK1151

Mitochondrion0.056

Rank 2 · TkA01G578820 · TK1151

Cytoplasm0.047

Rank 3 · TkA01G578820 · TK1151

Peroxisome0.039

Rank 4 · TkA01G578820 · TK1151

Cell membrane0.036

Rank 5 · TkA01G578820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08323Glyco_transf_579-339 aa

PF20706GT4-conflict90-133 aa

PF13439Glyco_transf_493-127 aa

PF13439Glyco_transf_4284-325 aa

PF20706GT4-conflict371-565 aa

PF00534Glycos_transf_1390-515 aa

PF13692Glyco_trans_1_4395-541 aa

PF13439Glyco_transf_4463-478 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578820	`PF08323`	Glyco_transf_5	79	339	8.7e-63	212.9
TkA01G578820	`PF20706`	GT4-conflict	90	133	1e-07	32.0
TkA01G578820	`PF13439`	Glyco_transf_4	93	127	0.12	13.1
TkA01G578820	`PF13439`	Glyco_transf_4	284	325	0.12	13.1
TkA01G578820	`PF20706`	GT4-conflict	371	565	1e-07	32.0
TkA01G578820	`PF00534`	Glycos_transf_1	390	515	5.8e-16	59.2
TkA01G578820	`PF13692`	Glyco_trans_1_4	395	541	7e-16	59.5
TkA01G578820	`PF13439`	Glyco_transf_4	463	478	0.12	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAQ0`	Arabidopsis thaliana	sp\|Q9MAQ0\|SSG1_ARATH Granule-bound starch synthase 1, chloroplastic/amyloplastic	69.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card