TkA01G578400 | RubberDandelionOmics

Gene overview

TkA01G578400

Reference: TK1151 Chr: Chr01 Coordinates: 145434385-145436090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · TkA01G578400|TK1151|cDNA

ATGTCTGGATCGTGTCTTTTGAATTTTAGTACTACATTTGAGACTGCAATGGAAAGGCAGAGACACAACCAGTGTGTTAATGATTTCAAAACATCTACCACTTTTCCCAAGACAGTAACATATCTACCATATGAACCACATGCTGCAAAAGTATATACACGTAGAGTTTTTTATCAGGTGCAGGAAGAGATTTTTCAATCTGACAAGGCATGTTTCCAAATGAATGTCGTTTCTGATTCAGGCATTGACACCGTGACGGT...

CDS

Download CDS FASTA

1113 bp · TkA01G578400|TK1151|CDS

ATGTCTGGATCGTGTCTTTTGAATTTTAGTACTACATTTGAGACTGCAATGGAAAGGCAGAGACACAACCAGTGTGTTAATGATTTCAAAACATCTACCACTTTTCCCAAGACAGTAACATATCTACCATATGAACCACATGCTGCAAAAGTATATACACGTAGAGTTTTTTATCAGGTGCAGGAAGAGATTTTTCAATCTGACAAGGCATGTTTCCAAATGAATGTCGTTTCTGATTCAGGCATTGACACCGTGACGGT...

Protein

Download Protein FASTA

370 aa · TkA01G578400|TK1151|PROTEIN

MSGSCLLNFSTTFETAMERQRHNQCVNDFKTSTTFPKTVTYLPYEPHAAKVYTRRVFYQVQEEIFQSDKACFQMNVVSDSGIDTVTVLEYSKNITTRKKKKVDIDDEVEEYHYDQLLVDTEFKVTHCREEGTFNCSCNHFQHVGILCRHIFCVLRYYRYEEIPERYILRRYCKDVVPTHLLTMRYQNPNDDKRTGMDTIEVFATVNQCVAVLSNQPEKMKEYLSEQLKLKKKYVDDCPPKEISNRNSQYAKMLGVSDTDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578400`
TK1151 ID	TkA01G578400
OH-1004 ID	LXL04_007412
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.600
Protein coverage (%)	TK1151 80.541 / OH-1004 40.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G578400

Location Chr01:145434385-145436090 (-)

Description Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11250`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g61290`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At5g18960`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007412 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G52520

ath:AT1G80010

ath:AT3G22170

ath:AT4G15090

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926

Rank 1 · TkA01G578400 · TK1151

Cytoplasm0.155

Rank 2 · TkA01G578400 · TK1151

Mitochondrion0.023

Rank 3 · TkA01G578400 · TK1151

Cell membrane0.016

Rank 4 · TkA01G578400 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G578400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07240Turandot15-31 aa

PF07240Turandot89-119 aa

PF04434SWIM134-150 aa

PF27558MTUS1_CCDC69_CC2203-231 aa

PF00804Syntaxin208-232 aa

PF00804Syntaxin319-356 aa

PF27558MTUS1_CCDC69_CC2319-354 aa

PF07240Turandot339-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578400	`PF07240`	Turandot	15	31	1.3	9.4
TkA01G578400	`PF07240`	Turandot	89	119	1.3	9.4
TkA01G578400	`PF04434`	SWIM	134	150	0.002	18.3
TkA01G578400	`PF27558`	MTUS1_CCDC69_CC2	203	231	0.95	10.4
TkA01G578400	`PF00804`	Syntaxin	208	232	0.0001	22.9
TkA01G578400	`PF00804`	Syntaxin	319	356	0.0001	22.9
TkA01G578400	`PF27558`	MTUS1_CCDC69_CC2	319	354	0.95	10.4
TkA01G578400	`PF07240`	Turandot	339	351	1.3	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXB0`	Arabidopsis thaliana	sp\|Q9SXB0\|SY125_ARATH Syntaxin-125	67.200%	Swiss-Prot	Low
`Q9ZVC9`	Arabidopsis thaliana	sp\|Q9ZVC9\|FRS3_ARATH Protein FAR1-RELATED SEQUENCE 3	29.300%	Swiss-Prot	Low
`O64791`	Arabidopsis thaliana	sp\|O64791\|SY124_ARATH Syntaxin-124	58.500%	Swiss-Prot	Low
`Q3E7I5`	Arabidopsis thaliana	sp\|Q3E7I5\|FRS12_ARATH Protein FAR1-RELATED SEQUENCE 12	27.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card