TkA01G577090 | RubberDandelionOmics

Gene overview

TkA01G577090

Reference: TK1151 Chr: Chr01 Coordinates: 145109377-145113795 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4329 bp · TkA01G577090|TK1151|cDNA

ATTTATTTTAAGAAAGACTTTAGACACTGAGTCACATCACAAAAGTCAAACTTGACACTTAGATTGAAGGACAAAATAGTAAACTTGTCTCATACGATGTGATGAGATGAGTGATGACGATAGACGACGCCTAAATCCTCCATTTTCCAGCTTTTAGCAACTCATTTAATACTGACACACAAATCTCTTAATTTCCTAAATTCAACCACACACATTTATATTTCTTATCAACCCATTTTCCTCTCAATCTCCATCTCTCC...

CDS

Download CDS FASTA

3678 bp · TkA01G577090|TK1151|CDS

ATGGCAGCATTCGAAAGCATTTCAAATCTGGTTTTTTACATTGTCGTTTTTTCTTTACTGCCATTAAAAGCCACATCGACATCAACTACACAAGCACAAGCTTTGATTAAATGGAAGCGTACCTTATTATCGTCTTCACTGGATTCATGGTCTTCTGGAAGCATTCAGAAGCTCTGCAACTGGACTGGTATTGTGTGCAATGAAGGTGGTACAGTTTCTGAAATTACCCTCCAAGAATCGTCACTTTCAGGAACGTTAAC...

Protein

Download Protein FASTA

1225 aa · TkA01G577090|TK1151|PROTEIN

MAAFESISNLVFYIVVFSLLPLKATSTSTTQAQALIKWKRTLLSSSLDSWSSGSIQKLCNWTGIVCNEGGTVSEITLQESSLSGTLTEFDFSSFPNLTHFNLSNNEFGGSIPSAIGNLSSIMFLDLSSNVLEDGIPLEIGRLRELRYLNLNDNSLNGVIPYQISNLQKVWYLDLGANYLTDPDWSDFSSMPALTFLNFYFNELENGFPGFILNCKKLTFLDLSINHFNGTLPESLFTNLNNIEYFNISENSFEGQLSTGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G577090`
TK1151 ID	TkA01G577090
OH-1004 ID	LXL04_000906
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 99.510 / OH-1004 51.910 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G577090

Location Chr01:145109377-145113795 (+)

Description Similar to MIK2: MDIS1-interacting receptor like kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
`At1g35710`	Probable leucine-rich repeat receptor-like protein kinase At1g35710.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000906 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0080027 response to herbivore Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G35710

ath:AT4G08850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · TkA01G577090 · TK1151

Endoplasmic reticulum0.085

Rank 2 · TkA01G577090 · TK1151

Cytoplasm0.059

Rank 3 · TkA01G577090 · TK1151

Nucleus0.038

Rank 4 · TkA01G577090 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA01G577090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_230-67 aa

PF25013LRR_Zer-176-131 aa

PF12799LRR_482-105 aa

PF13855LRR_890-131 aa

PF24048LRR_NXF1-592-168 aa

PF23286LRR_1393-130 aa

PF12799LRR_495-131 aa

PF13516LRR_695-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G577090	`PF08263`	LRRNT_2	30	67	1.9e-05	25.6
TkA01G577090	`PF25013`	LRR_Zer-1	76	131	1.1e-08	36.0
TkA01G577090	`PF12799`	LRR_4	82	105	4.2e-37	126.0
TkA01G577090	`PF13855`	LRR_8	90	131	1.4e-50	169.6
TkA01G577090	`PF24048`	LRR_NXF1-5	92	168	2.0	8.8
TkA01G577090	`PF23286`	LRR_13	93	130	0.00059	20.3
TkA01G577090	`PF12799`	LRR_4	95	131	4.2e-37	126.0
TkA01G577090	`PF13516`	LRR_6	95	110	0.00019	21.9
TkA01G577090	`PF00560`	LRR_1	96	118	3e-67	208.6
TkA01G577090	`PF23598`	LRR_14	96	300	1.1e-45	156.6
TkA01G577090	`PF29265`	LRR_CARMIL	100	153	0.39	10.0
TkA01G577090	`PF23211`	LRR_LRWD1	112	166	0.0022	18.4
TkA01G577090	`PF29594`	LRR_SKP2	119	151	0.0019	18.2
TkA01G577090	`PF13516`	LRR_6	120	133	0.00019	21.9
TkA01G577090	`PF00560`	LRR_1	122	142	3e-67	208.6
TkA01G577090	`PF12799`	LRR_4	124	156	4.2e-37	126.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG8`	Arabidopsis thaliana	sp\|Q8VZG8\|MIK2_ARATH MDIS1-interacting receptor like kinase 2	47.000%	Swiss-Prot	Low
`Q9LP24`	Arabidopsis thaliana	sp\|Q9LP24\|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710	43.200%	Swiss-Prot	Low
`Q9LVP0`	Arabidopsis thaliana	sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930	38.000%	Swiss-Prot	Low
`Q9SHI2`	Arabidopsis thaliana	sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	39.500%	Swiss-Prot	Low
`O49318`	Arabidopsis thaliana	sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170	36.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card