TkA01G575510 | RubberDandelionOmics

Gene overview

TkA01G575510

Reference: TK1151 Chr: Chr01 Coordinates: 144684948-144687453 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · TkA01G575510|TK1151|cDNA

AAAAATAAATCCACATCAGTAACAAGTACTCAAAAAGCTTTAGATTGGAAGCACAGCTATATTCCCTCTTCACCAATCCCTCGAGCTTGCTTGCAAAGAAAATCTTGATGTATATGATATGATATAGATTTTTTAGGCTCATTATTTTATAGGATTCTGACCAATTGATTCTTGTTTGGGAATAAAAAAAAGAGTCCTGATCAAGATGGGTTTGAGCGATATAGGAGCAAAGCTGCCACCAGGATTTAGATTCTACCCAA...

CDS

Download CDS FASTA

777 bp · TkA01G575510|TK1151|CDS

ATGGGTTTGAGCGATATAGGAGCAAAGCTGCCACCAGGATTTAGATTCTACCCAAGTGATGAAGAGTTGGTTTGCCACTATCTTTACAAGAAGATAGCTAATGAAGACGTTCTAAAGGGCACTCTTGTGGAAATTGATCTACATGTTTGTGAACCATGGCAACTTCCTGAGGTGGCGAAACTCAATGCAAGTGAGTGGTATTTCTTCAGCTTTCGTGATCGCAAGTATGCAACAGGATATCGAACCAATAGGGCCACCAA...

Protein

Download Protein FASTA

258 aa · TkA01G575510|TK1151|PROTEIN

MGLSDIGAKLPPGFRFYPSDEELVCHYLYKKIANEDVLKGTLVEIDLHVCEPWQLPEVAKLNASEWYFFSFRDRKYATGYRTNRATKTGYWKATGKDKTVVDPKTGALVGMRKTLVFYKNRAPNGIKTGWIMHEFRLENPQTAPKEDWVLCRVFHKAKGEIRNEIHSQNNTIQVTSPNTDTCPLRINHNQPQSCGCNHQIATVSSHQSSPLDHHYNRYDYYYPDFPPTIWQHRIGGIYKPSHCLLEHQVSRSRIWFVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G575510`
TK1151 ID	TkA01G575510
OH-1004 ID	LXL04_000930
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 87.597 / OH-1004 79.298 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G575510

Location Chr01:144684948-144687453 (-)

Description Similar to NAC021: NAC domain-containing protein 21/22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56010`	Transcriptional activator that mediates auxin signaling to promote lateral root development.	No verified direct reference in this release
`At1g76420`	Transcription activator.	The CUP-SHAPED COTYLEDON3 gene is required for boundary and shoot meristem formation in Arabidopsis.2003 · DOI: 10.1105/tpc.012203 Arabidopsis CUP-SHAPED COTYLEDON3 regulates postembryonic shoot meristem and organ boundary formation.2006 · DOI: 10.1105/tpc.106.045716
`At5g61430`	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO.	No verified direct reference in this release
`At5g53950`	Transcription activator of STM and KNAT6.	Shoot apical meristem and cotyledon formation during Arabidopsis embryogenesis: interaction among the CUP-SHAPED COTYLEDON and SHOOT MERISTEMLESS genes.1999 · DOI: 10.1242/dev.126.8.1563 Involvement of CUP-SHAPED COTYLEDON genes in gynoecium and ovule development in Arabidopsis thaliana.2000 · DOI: 10.1093/pcp/41.1.60 Roles of PIN-FORMED1 and MONOPTEROS in pattern formation of the apical region of the Arabidopsis embryo.2002 · DOI: 10.1242/dev.129.17.3965 The CUP-SHAPED COTYLEDON genes promote adventitious shoot formation on calli.2003 · DOI: 10.1093/pcp/pcg038 MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs.2004 · DOI: 10.1016/j.cub.2004.06.022 MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems.2004 · DOI: 10.1242/dev.01320 The early extra petals1 mutant uncovers a role for microRNA miR164c in regulating petal number in Arabidopsis.2005 · DOI: 10.1016/j.cub.2005.02.017 KNAT6: an Arabidopsis homeobox gene involved in meristem activity and organ separation.2006 · DOI: 10.1105/tpc.106.041988 The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis.2006 · DOI: 10.1105/tpc.106.045617 Arabidopsis CUP-SHAPED COTYLEDON3 regulates postembryonic shoot meristem and organ boundary formation.2006 · DOI: 10.1105/tpc.106.045716 Plants expressing a miR164-resistant CUC2 gene reveal the importance of post-meristematic maintenance of phyllotaxy in Arabidopsis.2007 · DOI: 10.1242/dev.02774 Redundancy and specialization among plant microRNAs: role of the MIR164 family in developmental robustness.2007 · DOI: 10.1242/dev.02817 Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.1997 · DOI: 10.1105/tpc.9.6.841
`At5g07680`	NAC domain-containing protein 79.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010014 meristem initiation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0048366 leaf development Biological Process

GO:0048527 lateral root development Biological Process

KEGG gene cross-reference

ath:AT1G56010

ath:AT1G76420

ath:AT5G53950

ath:AT5G61430

dosa:Os04g0460600

osa:4336052

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.875

Rank 1 · TkA01G575510 · TK1151

Cytoplasm0.173

Rank 2 · TkA01G575510 · TK1151

Cell membrane0.060

Rank 3 · TkA01G575510 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA01G575510 · TK1151

Plastid0.017

Rank 5 · TkA01G575510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM11-137 aa

PF03498CDtoxinA126-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G575510	`PF02365`	NAM	11	137	6.8e-44	150.0
TkA01G575510	`PF03498`	CDtoxinA	126	186	0.041	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TE6`	Arabidopsis thaliana	sp\|Q84TE6\|NAC22_ARATH NAC domain-containing protein 21/22	58.600%	Swiss-Prot	Medium
`Q9S851`	Arabidopsis thaliana	sp\|Q9S851\|NAC31_ARATH Protein CUP-SHAPED COTYLEDON 3	59.100%	Swiss-Prot	Medium
`Q9FLJ2`	Arabidopsis thaliana	sp\|Q9FLJ2\|NC100_ARATH NAC domain-containing protein 100	54.100%	Swiss-Prot	Medium
`O04017`	Arabidopsis thaliana	sp\|O04017\|NAC98_ARATH Protein CUP-SHAPED COTYLEDON 2	58.200%	Swiss-Prot	Medium
`Q9FLR3`	Arabidopsis thaliana	sp\|Q9FLR3\|NAC79_ARATH NAC domain-containing protein 79	56.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card