Gene Card
Gene overview
cDNA / CDS / Protein Sequences
339 bp · TkA01G575500|TK1151|cDNA
CCATGTTCAAAATCCCACTTCTGCCGTTGCTACCAACGCCGTCGACAGGTCCGGCATCGCGACAGGCTCTACCTTCCGTACCGTCGTCTGGATGGTGCATTTCGTTTGATTTTCATGGTGGATACAGAATGTCAAGTTTCTACGCGTAAAACATTTTCAACCATGCCAAATGAAAACAAACAAACTAAGAGAAAACAAGCAGATGAACTCACACCATTAAAGCTGAAGTGGGTTGAGAGAAATCATATTGATATTTACAA...
339 bp · TkA01G575500|TK1151|CDS
CCATGTTCAAAATCCCACTTCTGCCGTTGCTACCAACGCCGTCGACAGGTCCGGCATCGCGACAGGCTCTACCTTCCGTACCGTCGTCTGGATGGTGCATTTCGTTTGATTTTCATGGTGGATACAGAATGTCAAGTTTCTACGCGTAAAACATTTTCAACCATGCCAAATGAAAACAAACAAACTAAGAGAAAACAAGCAGATGAACTCACACCATTAAAGCTGAAGTGGGTTGAGAGAAATCATATTGATATTTACAA...
Protein
Download Protein FASTA113 aa · TkA01G575500|TK1151|PROTEIN
PCSKSHFCRCYQRRRQVRHRDRLYLPYRRLDGAFRLIFMVDTECQVSTRKTFSTMPNENKQTKRKQADELTPLKLKWVERNHIDIYKLQKSLKKRQWILHDQIIHSKNLDSKL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G575500 |
|---|---|
| TK1151 ID | TkA01G575500 |
| OH-1004 ID | LXL04_000931 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 96.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 39.649Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G575500 |
|---|---|
| Location | Chr01:144680140-144680966 (-) |
| Description | Similar to JMJ703: Lysine-specific demethylase JMJ703 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007623 circadian rhythm Biological Process GO:0009555 pollen development Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009908 flower development Biological Process GO:0009909 regulation of flower development Biological Process GO:0009910 negative regulation of flower development Biological Process |
| KEGG gene cross-reference | ath:AT1G08620 ath:AT1G30810 ath:AT2G34880 ath:AT4G20400 dosa:Os05g0196500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19902DUF637550-96 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G575500 | PF19902 | DUF6375 | 50 | 96 | 0.15 | 13.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.