TkA01G569170 | RubberDandelionOmics

Gene overview

TkA01G569170

Reference: TK1151 Chr: Chr01 Coordinates: 143245114-143249805 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · TkA01G569170|TK1151|cDNA

ATTTATCTAGTGATAGTATATGCAAATTTTAAAGGCAATATATGGTTATTTCATGATATGGTGCTACTCAAGAAACATGGTGTCTCTCAATGCTATCAAGGCTCTGTATCCATGTTGGATAATAAAATCAGATCTCACCCTTCAATAAATCAAAGTCTGTTCTTTAGGCGTAAGAAATACCCTGTTCAGGTAGTATGCAGTCAGAAGAAAGACATCCCTATAGTAGAGGCTCGGTCCATGGATGAAGTATATGATACTTT...

CDS

Download CDS FASTA

1083 bp · TkA01G569170|TK1151|CDS

TTGATCACTGGTCAACTGATACGTGGTAACAAACAACACGACGACCAGCCACGAGGCGCTTCAAGTGAAGTGCTGCCTGGAACCCTTCTCTCCACTCTCTCGTTTCTCCACTGTTTGCAGACGATGGATGTTTCTTCCTTCTCCACGACCTCAAGGCGATGCTGGCTTCTTTCCTCAGATATGGTGCTACTCAAGAAACATGGTGTCTCTCAATGCTATCAAGGCTCTGTATCCATGTTGGATAATAAAATCAGATCTCA...

Protein

Download Protein FASTA

360 aa · TkA01G569170|TK1151|PROTEIN

LITGQLIRGNKQHDDQPRGASSEVLPGTLLSTLSFLHCLQTMDVSSFSTTSRRCWLLSSDMVLLKKHGVSQCYQGSVSMLDNKIRSHPSINQSLFFRRKKYPVQVVCSQKKDIPIVEARSMDEVYDTLAERLVPTAASGTNTSMIHIVGLAGPPGAGKTTIASEVAKRVNKLWPEKACAFDSQVETPQIAVVLPMDGFHLYRHQLDSMEDPKEAHARRGAPWTFNPDLFLKCLKTLREQGSVYVPSFDHGVGDPVEDDIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G569170`
TK1151 ID	TkA01G569170
OH-1004 ID	LXL04_000986
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 94.444 / OH-1004 96.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G569170`
Location	Chr01:143245114-143249805 (-)
Description	Similar to SPAC227.14: Putative uridine kinase C227.14 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000986` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0044206 UMP salvage Biological Process GO:0044211 CTP salvage Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004849 uridine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016301 kinase activity Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0043771 cytidine kinase activity Molecular Function
KEGG gene cross-reference	ecj:JW2895 eco:b2928 ecoc:C3026_16040 vpo:Kpol_467p9 zro:ZYRO0F04752g These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA01G569170 · TK1151

Mitochondrion0.067

Rank 2 · TkA01G569170 · TK1151

Cytoplasm0.044

Rank 3 · TkA01G569170 · TK1151

Nucleus0.031

Rank 4 · TkA01G569170 · TK1151

Peroxisome0.023

Rank 5 · TkA01G569170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03308MeaB115-167 aa

PF02367TsaE129-169 aa

PF01078Mg_chelatase131-172 aa

PF05496RuvB_N135-170 aa

PF13191AAA_16141-210 aa

PF13604AAA_30143-169 aa

PF00931NB-ARC145-171 aa

PF24883NPHP3_N145-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G569170	`PF03308`	MeaB	115	167	0.081	12.6
TkA01G569170	`PF02367`	TsaE	129	169	0.18	12.5
TkA01G569170	`PF01078`	Mg_chelatase	131	172	0.026	14.7
TkA01G569170	`PF05496`	RuvB_N	135	170	0.0066	16.9
TkA01G569170	`PF13191`	AAA_16	141	210	0.0017	19.6
TkA01G569170	`PF13604`	AAA_30	143	169	0.2	12.1
TkA01G569170	`PF00931`	NB-ARC	145	171	0.0019	18.5
TkA01G569170	`PF24883`	NPHP3_N	145	172	0.016	16.1
TkA01G569170	`PF13245`	AAA_19	145	173	0.24	12.3
TkA01G569170	`PF20720`	nSTAND3	146	168	0.02	15.3
TkA01G569170	`PF00005`	ABC_tran	146	168	0.13	13.6
TkA01G569170	`PF00485`	PRK	147	331	4.4e-12	46.9
TkA01G569170	`PF01121`	CoaE	147	166	0.02	15.3
TkA01G569170	`PF13238`	AAA_18	148	183	5e-05	24.5
TkA01G569170	`PF03266`	NTPase_1	148	170	0.09	13.3
TkA01G569170	`PF13481`	AAA_25	149	170	0.074	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card