TkA01G565550 | RubberDandelionOmics

Gene overview

TkA01G565550

Reference: TK1151 Chr: Chr01 Coordinates: 142303772-142304958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

617 bp · TkA01G565550|TK1151|cDNA

AAAGATAATATATTTCATCAAGGTCACATACTAAAATTACCAAAAAATGGGTTCTAATAGGTCTCATATAGTTGGTCTAGTTGTGATTATAGTTATGGTCATGGTGATGCTGTGTGATGGAACCACAGTTGAGTCGTCGAAGTGTAGAAGTGCATTAGTGAGCTTGAGCCCGTGTCTTAACTATGTGAGCGGTAATTCATCGACTCCATCACACCCTTGTTGCTCGCAGCTCGCCAATGTTGTGAGATCAGAGCCACGCT...

CDS

Download CDS FASTA

441 bp · TkA01G565550|TK1151|CDS

ATGGGTTCTAATAGGTCTCATATAGTTGGTCTAGTTGTGATTATAGTTATGGTCATGGTGATGCTGTGTGATGGAACCACAGTTGAGTCGTCGAAGTGTAGAAGTGCATTAGTGAGCTTGAGCCCGTGTCTTAACTATGTGAGCGGTAATTCATCGACTCCATCACACCCTTGTTGCTCGCAGCTCGCCAATGTTGTGAGATCAGAGCCACGCTGTCTTTGTGTTTTGGTTGATGGAGGTAACTCAGCTACAAGCTTGAA...

Protein

Download Protein FASTA

146 aa · TkA01G565550|TK1151|PROTEIN

MGSNRSHIVGLVVIIVMVMVMLCDGTTVESSKCRSALVSLSPCLNYVSGNSSTPSHPCCSQLANVVRSEPRCLCVLVDGGNSATSLNINETLALGLPDVCNVHTPPVSRCDGNGTQSVPATSGGTTISLPFYLYFVLLLLASNLYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G565550`
TK1151 ID	TkA01G565550
OH-1004 ID	LXL04_001034
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 89.726 / OH-1004 47.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G565550

Location Chr01:142303772-142304958 (-)

Description Similar to LTPG2: Non-specific lipid transfer protein GPI-anchored 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22600`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At4g14815`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g48130`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g03103`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44300`	Probable lipid transfer protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001034 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006508 proteolysis Biological Process

GO:0006869 lipid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009845 seed germination Biological Process

GO:0010214 seed coat development Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G48130

ath:AT3G22600

ath:AT4G14815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.643

Rank 1 · TkA01G565550 · TK1151

Endoplasmic reticulum0.113

Rank 2 · TkA01G565550 · TK1151

Cytoplasm0.105

Rank 3 · TkA01G565550 · TK1151

Lysosome / Vacuole0.092

Rank 4 · TkA01G565550 · TK1151

Extracellular0.092

Rank 5 · TkA01G565550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_214-110 aa

PF00234Tryp_alpha_amyl33-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G565550	`PF14368`	LTP_2	14	110	9.3e-18	64.9
TkA01G565550	`PF00234`	Tryp_alpha_amyl	33	110	2.7e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ86`	Arabidopsis thaliana	sp\|Q9LJ86\|LTPG5_ARATH Non-specific lipid transfer protein GPI-anchored 5	52.400%	Swiss-Prot	High
`Q2PE59`	Arabidopsis thaliana	sp\|Q2PE59\|LTG26_ARATH Non-specific lipid transfer protein GPI-anchored 26	43.800%	Swiss-Prot	Medium
`Q7EB72`	Arabidopsis thaliana	sp\|Q7EB72\|LTG15_ARATH Non-specific lipid transfer protein GPI-anchored 15	43.200%	Swiss-Prot	Medium
`F4HZB9`	Arabidopsis thaliana	sp\|F4HZB9\|LTG19_ARATH Non-specific lipid transfer protein GPI-anchored 19	43.800%	Swiss-Prot	Medium
`O64865`	Arabidopsis thaliana	sp\|O64865\|LTG14_ARATH Non-specific lipid transfer protein GPI-anchored 14	37.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card