TkA01G564950 | RubberDandelionOmics

Gene overview

TkA01G564950

Reference: TK1151 Chr: Chr01 Coordinates: 142136603-142140047 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1257 bp · TkA01G564950|TK1151|cDNA

ATGATTCACTCCAAAGTTATTCAAGAAGGGGGGAAGTTGCAATACGGGAGAAGTACACAAATGAACCAAGTTTTCGAGGGTATAATCACCGCTAACGGGGTGGTGTGCGCATGTTGCAATGAAACTATGGGAATTTCAAAGTTTACATATCATGCAGGAGGCCTTATTGGAGAGTTTCATAAAGTATATTTGGAGACGGGAATGTCTTTTCTTGATTGCCTGAAAGTGTGTTGGAGACTAGAGGAGTCCAAGATTGTGCG...

CDS

Download CDS FASTA

1257 bp · TkA01G564950|TK1151|CDS

ATGATTCACTCCAAAGTTATTCAAGAAGGGGGGAAGTTGCAATACGGGAGAAGTACACAAATGAACCAAGTTTTCGAGGGTATAATCACCGCTAACGGGGTGGTGTGCGCATGTTGCAATGAAACTATGGGAATTTCAAAGTTTACATATCATGCAGGAGGCCTTATTGGAGAGTTTCATAAAGTATATTTGGAGACGGGAATGTCTTTTCTTGATTGCCTGAAAGTGTGTTGGAGACTAGAGGAGTCCAAGATTGTGCG...

Protein

Download Protein FASTA

418 aa · TkA01G564950|TK1151|PROTEIN

MIHSKVIQEGGKLQYGRSTQMNQVFEGIITANGVVCACCNETMGISKFTYHAGGLIGEFHKVYLETGMSFLDCLKVCWRLEESKIVRFNTIASTDDNFIDDTCDKCGYTGFLVGCDSCPAKIHPNCNQAQKHGGQWRCEYCLCKFCLHTNRWALDSEELLSCALCEDKFHEPCGKENGGKGDCPNMYFCGTTCHETYRRLQSVLGNNRGLGDGFSFSILKRYDFRPDLETDAATIAMNSKLAVAVSIINETFLSSIDERT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G564950`
TK1151 ID	TkA01G564950
OH-1004 ID	LXL04_001042
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 55.218 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G564950

Location Chr01:142136603-142140047 (+)

Description Similar to IDM1: Increased DNA methylation 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14980`	Histone H3 acetyltransferase that binds methylated DNA at chromatin sites lacking histone H3K4 di- or trimethylation and catalyzes H3K18 and H3K23 acetylation.	A histone acetyltransferase regulates active DNA demethylation in Arabidopsis.2012 · DOI: 10.1126/science.1219416 Antisilencing role of the RNA-directed DNA methylation pathway and a histone acetyltransferase in Arabidopsis.2012 · DOI: 10.1073/pnas.1208557109 Regulation of active DNA demethylation by an α-crystallin domain protein in Arabidopsis.2014 · DOI: 10.1016/j.molcel.2014.06.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001042 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004402 histone acetyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0010385 double-stranded methylated DNA binding Molecular Function

GO:0042393 histone binding Molecular Function

GO:0043993 histone H3K18 acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G14980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.611

Rank 1 · TkA01G564950 · TK1151

Cytoplasm0.437

Rank 2 · TkA01G564950 · TK1151

Cell membrane0.047

Rank 3 · TkA01G564950 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA01G564950 · TK1151

Mitochondrion0.023

Rank 5 · TkA01G564950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16135TDBD27-77 aa

PF00628PHD36-41 aa

PF00628PHD103-141 aa

PF16135TDBD142-148 aa

PF00628PHD143-189 aa

PF23209IDM1_C252-390 aa

PF13673Acetyltransf_10276-370 aa

PF00583Acetyltransf_1277-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G564950	`PF16135`	TDBD	27	77	1.3e-11	45.0
TkA01G564950	`PF00628`	PHD	36	41	0.0078	16.9
TkA01G564950	`PF00628`	PHD	103	141	0.0078	16.9
TkA01G564950	`PF16135`	TDBD	142	148	1.3e-11	45.0
TkA01G564950	`PF00628`	PHD	143	189	0.0078	16.9
TkA01G564950	`PF23209`	IDM1_C	252	390	2.7e-53	180.5
TkA01G564950	`PF13673`	Acetyltransf_10	276	370	0.045	14.5
TkA01G564950	`PF00583`	Acetyltransf_1	277	347	0.00035	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IXE7`	Arabidopsis thaliana	sp\|F4IXE7\|IDM1_ARATH Increased DNA methylation 1	37.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card