TkA01G563350 | RubberDandelionOmics

Gene overview

TkA01G563350

Reference: TK1151 Chr: Chr01 Coordinates: 141628995-141630065 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · TkA01G563350|TK1151|cDNA

ATGGCCTTTCGGAGCTTCGATTGTCTTCTACTCCTCATCGGCCTCCTGTCTCTGTCCATCCAACCACCATCAACCGCCCTTGCCGCCACCAATATCCGCCTCACCCGTAATCGAAAACTATCCCAAAATGTCCCTTATTTTCGTGAAGCCCCGGGGTTTCGTAATGGCCAGGCATGTGGTTCCTCTCCCAGCGACCGAATCCATTTAGCAATGACTCTCGATTGCAACTACTTACGTGGGACAATGGCCGCCGTCCAGTC...

CDS

Download CDS FASTA

1023 bp · TkA01G563350|TK1151|CDS

ATGGCCTTTCGGAGCTTCGATTGTCTTCTACTCCTCATCGGCCTCCTGTCTCTGTCCATCCAACCACCATCAACCGCCCTTGCCGCCACCAATATCCGCCTCACCCGTAATCGAAAACTATCCCAAAATGTCCCTTATTTTCGTGAAGCCCCGGGGTTTCGTAATGGCCAGGCATGTGGTTCCTCTCCCAGCGACCGAATCCATTTAGCAATGACTCTCGATTGCAACTACTTACGTGGGACAATGGCCGCCGTCCAGTC...

Protein

Download Protein FASTA

340 aa · TkA01G563350|TK1151|PROTEIN

MAFRSFDCLLLLIGLLSLSIQPPSTALAATNIRLTRNRKLSQNVPYFREAPGFRNGQACGSSPSDRIHLAMTLDCNYLRGTMAAVQSRLRFDQDIKTSIKTTFPYLNFKLYRFNSNLVQGKISKSIREALDEPLNYARIYLADIIPTYVKRIIYLDSDLVVVDDIEKLWRVDLQDKVLAAPEYCQANFTQYFNDNFWADPELGKIFKGKNPCYFNTGVMVLDVEKWRQRGYLQKLEQWMAVQKQKRIYHLGSLPPFLLVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G563350`
TK1151 ID	TkA01G563350
OH-1004 ID	LXL04_001071
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G563350

Location Chr01:141628995-141630065 (-)

Description Similar to GATL4: Probable galacturonosyltransferase-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06260`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g13250`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g70090`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g02720`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001071 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045489 pectin biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048363 mucilage pectin metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071668 plant-type cell wall assembly Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02720

ath:AT1G13250

ath:AT1G24170

ath:AT1G70090

ath:AT3G06260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.574

Rank 1 · TkA01G563350 · TK1151

Endoplasmic reticulum0.161

Rank 2 · TkA01G563350 · TK1151

Extracellular0.100

Rank 3 · TkA01G563350 · TK1151

Cytoplasm0.084

Rank 4 · TkA01G563350 · TK1151

Cell membrane0.068

Rank 5 · TkA01G563350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15040Humanin1-13 aa

PF01501Glyco_transf_869-307 aa

PF18404Glyco_transf_2499-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G563350	`PF15040`	Humanin	1	13	1.0	9.6
TkA01G563350	`PF01501`	Glyco_transf_8	69	307	2.6e-50	172.1
TkA01G563350	`PF18404`	Glyco_transf_24	99	235	9e-09	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8J2`	Arabidopsis thaliana	sp\|Q9M8J2\|GATL4_ARATH Probable galacturonosyltransferase-like 4	66.000%	Swiss-Prot	High
`Q0V7R1`	Arabidopsis thaliana	sp\|Q0V7R1\|GATL3_ARATH Probable galacturonosyltransferase-like 3	58.600%	Swiss-Prot	High
`O04536`	Arabidopsis thaliana	sp\|O04536\|GATL9_ARATH Probable galacturonosyltransferase-like 9	51.800%	Swiss-Prot	High
`Q9FWY9`	Arabidopsis thaliana	sp\|Q9FWY9\|GATL5_ARATH Probable galacturonosyltransferase-like 5	52.800%	Swiss-Prot	High
`Q8VYF4`	Arabidopsis thaliana	sp\|Q8VYF4\|GATL7_ARATH Probable galacturonosyltransferase-like 7	50.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card