TkA01G562040 | RubberDandelionOmics

Gene overview

TkA01G562040

Reference: TK1151 Chr: Chr01 Coordinates: 141323853-141326896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1181 bp · TkA01G562040|TK1151|cDNA

ATGCAGGCACGAGTCTTCGGGCCATCGGTCCTCCCTCCCACTTCCATTACAGCCTTGTCGACATTCCCAACTTCTTTAAATCTTTTTCTTTCCAGCAAACCGCCGAAGTCATGTAGGAGCAAGAAGCTAGAAGATGAAGTCTTAGCCGGTCTCCCTAAACAATTCCATGATGAAGAATGGCAAGCACGTCAGCGAGAGAAGACTAAAGAAATAGAAAGACTGCGTAGAGAGGAAGATGAAGAAGAAGAAAGAATAGTTGA...

CDS

Download CDS FASTA

909 bp · TkA01G562040|TK1151|CDS

ATGCAGGCACGAGTCTTCGGGCCATCGGTCCTCCCTCCCACTTCCATTACAGCCTTGTCGACATTCCCAACTTCTTTAAATCTTTTTCTTTCCAGCAAACCGCCGAAGTCATGTAGGAGCAAGAAGCTAGAAGATGAAGTCTTAGCCGGTCTCCCTAAACAATTCCATGATGAAGAATGGCAAGCACGTCAGCGAGAGAAGACTAAAGAAATAGAAAGACTGCGTAGAGAGGAAGATGAAGAAGAAGAAAGAATAGTTGA...

Protein

Download Protein FASTA

302 aa · TkA01G562040|TK1151|PROTEIN

MQARVFGPSVLPPTSITALSTFPTSLNLFLSSKPPKSCRSKKLEDEVLAGLPKQFHDEEWQARQREKTKEIERLRREEDEEEERIVDEYREVGMLLKNYPQEDVFKAKKLVSSFIKSAEEIEEKIEEAAEKGELNELVLMVIWTRLDLARRRGRKRCYKSLDLLYRRVETEILKRQATPAMRLLNDLLMMHDGFDDDGWLKACKKRMIETFPREDPFSLLVPTGFDLDKHHGPLVRPAMEADDLLLRIDFIREVDTLLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G562040`
TK1151 ID	TkA01G562040
OH-1004 ID	LXL04_001088
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	95.900
Protein coverage (%)	TK1151 96.026 / OH-1004 94.463 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G562040

Location Chr01:141323853-141326896 (-)

Description Similar to PAC: Protein PALE CRESS, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g48120`	Required for the differentiation of chloroplast from proplastids or etioplasts, probably by modulating some chloroplast-encoded genes expression and mRNA maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001088 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010239 chloroplast mRNA processing Biological Process

GO:0016070 RNA metabolic process Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009513 etioplast Cellular Component

GO:0009537 proplastid Cellular Component

KEGG gene cross-reference

ath:AT2G48120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.836

Rank 1 · TkA01G562040 · TK1151

Mitochondrion0.107

Rank 2 · TkA01G562040 · TK1151

Nucleus0.086

Rank 3 · TkA01G562040 · TK1151

Cytoplasm0.033

Rank 4 · TkA01G562040 · TK1151

Cell membrane0.017

Rank 5 · TkA01G562040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03822NAF28-39 aa

PF05291Bystin41-114 aa

PF28684PAC_N_CC57-93 aa

PF19056WD40_259-156 aa

PF28683PAC_M76-85 aa

PF28683PAC_M97-177 aa

PF03822NAF116-134 aa

PF28684PAC_N_CC119-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G562040	`PF03822`	NAF	28	39	0.87	10.5
TkA01G562040	`PF05291`	Bystin	41	114	0.0097	16.0
TkA01G562040	`PF28684`	PAC_N_CC	57	93	3e-16	59.9
TkA01G562040	`PF19056`	WD40_2	59	156	0.44	9.9
TkA01G562040	`PF28683`	PAC_M	76	85	4e-37	126.9
TkA01G562040	`PF28683`	PAC_M	97	177	4e-37	126.9
TkA01G562040	`PF03822`	NAF	116	134	0.87	10.5
TkA01G562040	`PF28684`	PAC_N_CC	119	127	3e-16	59.9
TkA01G562040	`PF03822`	NAF	276	292	0.87	10.5
TkA01G562040	`PF28684`	PAC_N_CC	284	290	3e-16	59.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39089`	Arabidopsis thaliana	sp\|Q39089\|PAC_ARATH Protein PALE CRESS, chloroplastic	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card