TkA01G561650 | RubberDandelionOmics

Gene overview

TkA01G561650

Reference: TK1151 Chr: Chr01 Coordinates: 141236961-141239109 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1214 bp · TkA01G561650|TK1151|cDNA

GCCAATTTCAAGAGATGGTATTTACTTGTTGCACAAGGTCGGACTAAATTATCCAGGAATGTCTATATAGTTACCACTTGTCAAAACCGGAAAAAAAAACAAAAGCGGTGGACGTTGTTTTCTGTAAAAATGGCGAAGAAGCTTGTCAAATATTCTGTGGTGGATGCATTTACTGAAACGGCGTTTAAAGGAAATCCGGCGGCTGTGTGTTGTTAGAGGACACAGAGAAAGATGATAAGTGGTTGCAGTCAGTTGCGACT...

CDS

Download CDS FASTA

486 bp · TkA01G561650|TK1151|CDS

ATGAAGGACTCCTCAGGCACCGAAAATGGTGCGACGCAGGCCAGCTTATTAATCGAATTGAACTTCCCTGTCGTGCCAATTTCGGAATTCAATGATCTTGAGGTTACAGCAGTTTCCGAAATACTAAATGGTGTTTCTATTGTTGATATAAAGAAGATTGCAACTAATGACATTCTTGTGGTGCTTCCGTCGGCAAAGGAAGTTGTGGAATTTGAGCCACAACTTGATAAGATCAAAAAAGCACCAGGCAGAGGGATAGT...

Protein

Download Protein FASTA

161 aa · TkA01G561650|TK1151|PROTEIN

MKDSSGTENGATQASLLIELNFPVVPISEFNDLEVTAVSEILNGVSIVDIKKIATNDILVVLPSAKEVVEFEPQLDKIKKAPGRGIVITGLAPHESGFDFYTRFFCPKYGIDEDPVCGSAHCALAAYWSEKLGKCNLIAYQASPRSGILDIHLDKKSKSTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G561650`
TK1151 ID	TkA01G561650
OH-1004 ID	LXL04_001092
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.500
Protein coverage (%)	TK1151 93.789 / OH-1004 27.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G561650`
Location	Chr01:141236961-141239109 (-)
Description	Similar to BH0283: Uncharacterized isomerase BH0283 (Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001092` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0030277 maintenance of gastrointestinal epithelium Biological Process GO:0032479 regulation of type I interferon production Biological Process GO:0032481 positive regulation of type I interferon production Biological Process GO:0032728 positive regulation of interferon-beta production Biological Process GO:0043122 regulation of canonical NF-kappaB signal transduction Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0003824 catalytic activity Molecular Function GO:0016853 isomerase activity Molecular Function GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	bha:BH0283 mmu:68371 pae:PA2770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.741

Rank 1 · TkA01G561650 · TK1151

Nucleus0.410

Rank 2 · TkA01G561650 · TK1151

Mitochondrion0.058

Rank 3 · TkA01G561650 · TK1151

Peroxisome0.053

Rank 4 · TkA01G561650 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA01G561650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02567PhzC-PhzF8-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G561650	`PF02567`	PhzC-PhzF	8	157	1.5e-33	117.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card