RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G558460
Reference: TK1151 Chr: Chr01 Coordinates: 140474832-140476778 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1506 bp · TkA01G558460|TK1151|cDNA

ATGTCGAATATTACAGGAGATGAAGGAAGCTTTTCATCAGGAGAAGAAGCTCAAGGAAAGCAAGTTCAAGACCTGAAAAACCATTTTAACGGAGGAAATTCTAGCAATGTCTCCACTTCACTCCCACCTCCTCCTGCTAAAAAGAAAAGAAGCCTGCCAGGAACTCCAGATCCTACAGCAGAAGTTATTGCGTTATCACCAACGACACTTATGGCAACCAATAGATTTGTATGTGAAATATGCAACAAAGGGTTTCAGAG...

CDS

Download CDS FASTA

1506 bp · TkA01G558460|TK1151|CDS

ATGTCGAATATTACAGGAGATGAAGGAAGCTTTTCATCAGGAGAAGAAGCTCAAGGAAAGCAAGTTCAAGACCTGAAAAACCATTTTAACGGAGGAAATTCTAGCAATGTCTCCACTTCACTCCCACCTCCTCCTGCTAAAAAGAAAAGAAGCCTGCCAGGAACTCCAGATCCTACAGCAGAAGTTATTGCGTTATCACCAACGACACTTATGGCAACCAATAGATTTGTATGTGAAATATGCAACAAAGGGTTTCAGAG...

Protein

Download Protein FASTA

501 aa · TkA01G558460|TK1151|PROTEIN

MSNITGDEGSFSSGEEAQGKQVQDLKNHFNGGNSSNVSTSLPPPPAKKKRSLPGTPDPTAEVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQRTSTETRKRVYVCPEPSCVHHNPARALGDLTGIKKHYSRKHGEKKWKCDKCSKKYAVQSDWKAHQKTCGTREYKCDCGTIFSRRDSFITHRAFCDALAEENNKVNHGMLHPTHHMHDQSMDSGNNMLMGLPNFNNYEPKDSIKSLPQDLVPMPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G558460
TK1151 IDTkA01G558460
OH-1004 IDLXL04_001131
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.300
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G558460
LocationChr01:140474832-140476778 (+)
DescriptionSimilar to GAF1: Zinc finger protein GAI-ASSOCIATED FACTOR 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g50700 Transcription factor that acts as a positive regulator of gibberellin (GA) action, homeostasis and signaling. No verified direct reference in this release
At1g03840 Transcription factor that regulates tissue boundaries and asymmetric cell division.
DELLA protein functions as a transcriptional activator through the DNA binding of the indeterminate domain family proteins.2014 · DOI: 10.1073/pnas.1321669111
At5g44160 Transcription activator that binds to the DNA sequence 5'-CTTTTGTCC-3'.
Modulation of sugar metabolism by an INDETERMINATE DOMAIN transcription factor contributes to photoperiodic flowering in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2010.04432.x
AKIN10 delays flowering by inactivating IDD8 transcription factor through protein phosphorylation in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0503-8
At5g66730 Transcription factor promoting the transition to germination by regulating light and hormonal signaling during seed maturation.
The Arabidopsis C2H2 zinc finger INDETERMINATE DOMAIN1/ENHYDROUS promotes the transition to germination by regulating light and hormonal signaling during seed maturation.2011 · DOI: 10.1105/tpc.111.085134
DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.2014 · DOI: 10.1105/tpc.114.125690
At1g55110 Probable transcription factor. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001131 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002221 pattern recognition receptor signaling pathway Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008356 asymmetric cell division Biological Process
GO:0009740 gibberellic acid mediated signaling pathway Biological Process
GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010336 gibberellic acid homeostasis Biological Process
GO:0010431 seed maturation Biological Process
GO:0034504 protein localization to nucleus Biological Process
KEGG gene cross-reference
ath:AT1G03840
ath:AT1G14580
ath:AT2G02080
ath:AT3G50700
ath:AT5G66730
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972
Rank 1 · TkA01G558460 · TK1151
Cytoplasm0.120
Rank 2 · TkA01G558460 · TK1151
Cell membrane0.018
Rank 3 · TkA01G558460 · TK1151
Mitochondrion0.011
Rank 4 · TkA01G558460 · TK1151
Endoplasmic reticulum0.008
Rank 5 · TkA01G558460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12171zf-C2H2_jaz23-31 aa
PF12874zf-met24-31 aa
PF23115zf-C2H2_STOP2_3rd25-29 aa
PF26040Zn_ribbon_CLPX_N68-83 aa
PF04810zf-Sec23_Sec2472-83 aa
PF23250zf_DPOE_273-88 aa
PF02892zf-BED74-88 aa
PF22995C2CH-3rd_BIRD-IDD75-85 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G558460PF12171zf-C2H2_jaz23310.001419.5
TkA01G558460PF12874zf-met24310.001819.3
TkA01G558460PF23115zf-C2H2_STOP2_3rd25290.1612.8
TkA01G558460PF26040Zn_ribbon_CLPX_N68830.7210.4
TkA01G558460PF04810zf-Sec23_Sec2472831.010.2
TkA01G558460PF23250zf_DPOE_273880.1212.8
TkA01G558460PF02892zf-BED74880.3511.6
TkA01G558460PF22995C2CH-3rd_BIRD-IDD75853.5e-1452.9
TkA01G558460PF13912zf-C2H2_675980.0215.6
TkA01G558460PF00096zf-C2H276981.8e-0938.2
TkA01G558460PF12171zf-C2H2_jaz76980.001419.5
TkA01G558460PF12874zf-met76980.001819.3
TkA01G558460PF13894zf-C2H2_476980.007717.6
TkA01G558460PF21361Sina_ZnF1061540.7311.0
TkA01G558460PF26408DUF81061101210.5910.6
TkA01G558460PF22996C2H2-2nd_BIRD-IDD1131474.3e-2381.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SCQ6Arabidopsis thalianasp|Q9SCQ6|IDD2_ARATH Zinc finger protein GAI-ASSOCIATED FACTOR 182.600%Swiss-ProtLow
Q9ZWA6Arabidopsis thalianasp|Q9ZWA6|IDD3_ARATH Zinc finger protein MAGPIE83.700%Swiss-ProtLow
Q9FFH3Arabidopsis thalianasp|Q9FFH3|IDD8_ARATH Zinc finger protein NUTCRACKER84.800%Swiss-ProtLow
Q9LVQ7Arabidopsis thalianasp|Q9LVQ7|IDD1_ARATH Zinc finger protein ENHYDROUS83.900%Swiss-ProtLow
Q8H1F5Arabidopsis thalianasp|Q8H1F5|IDD7_ARATH Protein indeterminate-domain 752.800%Swiss-ProtMedium

JBrowse

View in Genome Browser