TkA01G557480 | RubberDandelionOmics

Gene overview

TkA01G557480

Reference: TK1151 Chr: Chr01 Coordinates: 140190895-140192237 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · TkA01G557480|TK1151|cDNA

ATGTCGGTGTTACCAAAAGTACAGGGGCTAAAGATTAGGAAGACGATCGATGCAGTTGATCAGCTGAGAGGATTACCCTCTGGAGGTGACGTGGAGCCTGGTGAGATTCCTTCATTGGTTGATTTGGGTCTTAACCCTACTGCTACCATGAATCAGGCTAAAGCAAGTGCAAATGCTTCACTTGTTGGAGGTGAGACGGAAGCACTTGAGAGGCTTAAAAAGTTTGCTGCGGAATGCCAAACACAGCCTCATAAAGAAGG...

CDS

Download CDS FASTA

735 bp · TkA01G557480|TK1151|CDS

ATGTCGGTGTTACCAAAAGTACAGGGGCTAAAGATTAGGAAGACGATCGATGCAGTTGATCAGCTGAGAGGATTACCCTCTGGAGGTGACGTGGAGCCTGGTGAGATTCCTTCATTGGTTGATTTGGGTCTTAACCCTACTGCTACCATGAATCAGGCTAAAGCAAGTGCAAATGCTTCACTTGTTGGAGGTGAGACGGAAGCACTTGAGAGGCTTAAAAAGTTTGCTGCGGAATGCCAAACACAGCCTCATAAAGAAGG...

Protein

Download Protein FASTA

244 aa · TkA01G557480|TK1151|PROTEIN

MSVLPKVQGLKIRKTIDAVDQLRGLPSGGDVEPGEIPSLVDLGLNPTATMNQAKASANASLVGGETEALERLKKFAAECQTQPHKEGGNDSSSIYGANFSCKISPWLAMGCLSPRSMFDELKKSASRYITISGRKDGGDGGTNWLMYELLWRDFFRFITKKYSSAKQIMLLQSQLVSHDELRFDAKMYLLFGHVYIPIKLCFCFIRMPKMFCHLRCFMNSILHGNIHYVEHKLLNHYKGLFCLM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G557480`
TK1151 ID	TkA01G557480
OH-1004 ID	LXL04_001158
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 66.393 / OH-1004 37.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G557480

Location Chr01:140190895-140192237 (+)

Description Similar to PHR2: Blue-light photoreceptor PHR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47590`	Blue-light photoreceptor PHR2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001158 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000719 photoreactive repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003684 damaged DNA binding Molecular Function

GO:0003904 deoxyribodipyrimidine photo-lyase activity Molecular Function

GO:0003913 DNA photolyase activity Molecular Function

GO:0009881 photoreceptor activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT2G47590

dre:402986

gvi:glr0835

syn:sll1629

xla:403387

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.420

Rank 1 · TkA01G557480 · TK1151

Cytoplasm0.323

Rank 2 · TkA01G557480 · TK1151

Cell membrane0.141

Rank 3 · TkA01G557480 · TK1151

Mitochondrion0.125

Rank 4 · TkA01G557480 · TK1151

Endoplasmic reticulum0.101

Rank 5 · TkA01G557480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB72`	Arabidopsis thaliana	sp\|Q8LB72\|PHR2_ARATH Blue-light photoreceptor PHR2	65.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card