TkA01G557250 | RubberDandelionOmics

Gene overview

TkA01G557250

Reference: TK1151 Chr: Chr01 Coordinates: 140114237-140122793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1309 bp · TkA01G557250|TK1151|cDNA

ACGCACCCTCCTCTGATCGATGGAGCACACCAAAGGTAACCTTATAAAAACAAATCGATTACAACCTACATATGAAAACAAACATGGAGAATATACAACATAAAAATATAAAAGTAAATGACATTAATATGCATGTCGCCGAGATCGGGGAAGGCCCTGCCGTGCTTTTTATCCATGGCTTCCCAGAGCTATGGTACACATGGCGTCACCAAATGTTGTTTATATCCTCTAAAGGGTACCGGGCCATTGCGCCCGACCTT...

CDS

Download CDS FASTA

960 bp · TkA01G557250|TK1151|CDS

ATGAAAACAAACATGGAGAATATACAACATAAAAATATAAAAGTAAATGACATTAATATGCATGTCGCCGAGATCGGGGAAGGCCCTGCCGTGCTTTTTATCCATGGCTTCCCAGAGCTATGGTACACATGGCGTCACCAAATGTTGTTTATATCCTCTAAAGGGTACCGGGCCATTGCGCCCGACCTTCGTGGGTTTGGTGATTCGGAGGCACCACCTTCCTCCACCAGCTACACCGCCTTGCACATAGTCGGAGACCT...

Protein

Download Protein FASTA

319 aa · TkA01G557250|TK1151|PROTEIN

MKTNMENIQHKNIKVNDINMHVAEIGEGPAVLFIHGFPELWYTWRHQMLFISSKGYRAIAPDLRGFGDSEAPPSSTSYTALHIVGDLVCLLDSLGLDKVFLVGHDWGAIIAWYMCLFRPDRIKALVNMSVVYNPRNPLVKPMEFMRQTFGDDFYICRFQEIGWEEEFAKVDTKMLLASFYFKRHPKPPMMSKDFAKDFKPTPCNVPCWFTDEDLDYFASKYHATGFAGPFNYYRCFDLNWELCAAWTGSKIMVPVKFIVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G557250`
TK1151 ID	TkA01G557250
OH-1004 ID	LXL04_001161
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G557250`
Location	Chr01:140114237-140122793 (+)
Description	Similar to ephA: Epoxide hydrolase A (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001161` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	mtu:Rv3617 mtv:RVBD_3617 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.825

Rank 1 · TkA01G557250 · TK1151

Nucleus0.377

Rank 2 · TkA01G557250 · TK1151

Peroxisome0.062

Rank 3 · TkA01G557250 · TK1151

Mitochondrion0.055

Rank 4 · TkA01G557250 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA01G557250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07224Chlorophyllase24-70 aa

PF00561Abhydrolase_129-149 aa

PF12146Hydrolase_430-149 aa

PF12697Abhydrolase_631-309 aa

PF03096Ndr81-131 aa

PF00561Abhydrolase_1284-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G557250	`PF07224`	Chlorophyllase	24	70	0.00064	19.3
TkA01G557250	`PF00561`	Abhydrolase_1	29	149	1.8e-28	100.6
TkA01G557250	`PF12146`	Hydrolase_4	30	149	5.9e-10	39.6
TkA01G557250	`PF12697`	Abhydrolase_6	31	309	4.3e-21	77.3
TkA01G557250	`PF03096`	Ndr	81	131	0.14	11.5
TkA01G557250	`PF00561`	Abhydrolase_1	284	304	1.8e-28	100.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card