TkA01G556350 | RubberDandelionOmics

Gene overview

TkA01G556350

Reference: TK1151 Chr: Chr01 Coordinates: 139855215-139857593 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2067 bp · TkA01G556350|TK1151|cDNA

CGGAAATCTGTTTTTGGTTTTCTCTGTGAGGGAAATGGAGCCGTTACTTGCACTTTTGCTAAGATAAAAACACCTCACCTCACATAACGTTAACTTCTCACCTCTCCTTACCTTTTTGTCTCATCTTCACTTCCACTTTCATTTTCCCAACGCCAATTTTAGGGTTTTGTTTCATTCTATCGTCCTTCAGATCCAAACAACAGAAACCCCAAAACAACCCCCATCAAATTCGAGGGCGTTTTGTTTGATTGTTCCATGGA...

CDS

Download CDS FASTA

1590 bp · TkA01G556350|TK1151|CDS

ATGGATGAAACTGATAATGGTAGAGTTGAAGCATTTGATTCGGATCACAATGTCAAGTACCGATTTGGTGAATCAGGTTCGGACCAGGAACAAAACAATGGTAGTGTCGTGAGGGGCGAAGTGGACACGTCGGCGCCTTTTGAGTCGGTGAAGGAAGCTGTGTCCCGATTCGGCGGAGTTGGGTTCTGGAAACCCCATCATAAGCACACCCATTCTTCGCAGAATGGCCTTGAAGAAGAATTTGATGCAGCAAAAGCGGA...

Protein

Download Protein FASTA

529 aa · TkA01G556350|TK1151|PROTEIN

MDETDNGRVEAFDSDHNVKYRFGESGSDQEQNNGSVVRGEVDTSAPFESVKEAVSRFGGVGFWKPHHKHTHSSQNGLEEEFDAAKAEEQAAQLANELIVKERETLQVLKELEATKTTLEELKTKLQKESETVHNQKTPQSADDNFLCPSSAPGFILMELKQAKLNLTRTTSDLADIRATVEIYNKKIEKERYELEQTRRRLSSKSSNLSSFKENQEQDLDDYIPKELQRLTSETNEFKKIGELAKSGVLKAMNQIEQTKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G556350`
TK1151 ID	TkA01G556350
OH-1004 ID	LXL04_011958
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.700
Protein coverage (%)	TK1151 40.454 / OH-1004 38.068 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G556350

Location Chr01:139855215-139857593 (+)

Description Similar to At2g40480: WEB family protein At2g40480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38370`	WEB family protein At2g38370.	No verified direct reference in this release
`At3g51720`	WEB family protein At3g51720.	No verified direct reference in this release
`At2g40480`	WEB family protein At2g40480.	No verified direct reference in this release
`At3g56270`	WEB family protein At3g56270.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G38370

ath:AT2G40480

ath:AT3G51720

ath:AT3G56270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.462

Rank 1 · TkA01G556350 · TK1151

Cell membrane0.349

Rank 2 · TkA01G556350 · TK1151

Nucleus0.330

Rank 3 · TkA01G556350 · TK1151

Plastid0.049

Rank 4 · TkA01G556350 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA01G556350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701WEMBL39-129 aa

PF05701WEMBL157-389 aa

PF11014DUF2852186-239 aa

PF11014DUF2852334-366 aa

PF25184YxzE447-488 aa

PF25184YxzE504-517 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G556350	`PF05701`	WEMBL	39	129	6.6e-46	157.9
TkA01G556350	`PF05701`	WEMBL	157	389	6.6e-46	157.9
TkA01G556350	`PF11014`	DUF2852	186	239	0.48	11.3
TkA01G556350	`PF11014`	DUF2852	334	366	0.48	11.3
TkA01G556350	`PF25184`	YxzE	447	488	0.011	17.5
TkA01G556350	`PF25184`	YxzE	504	517	0.011	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4ISY0`	Arabidopsis thaliana	sp\|F4ISY0\|Y2837_ARATH WEB family protein At2g38370	44.000%	Swiss-Prot	Medium
`Q9SCT6`	Arabidopsis thaliana	sp\|Q9SCT6\|Y3172_ARATH WEB family protein At3g51720	36.100%	Swiss-Prot	Medium
`Q5XVC7`	Arabidopsis thaliana	sp\|Q5XVC7\|Y2048_ARATH WEB family protein At2g40480	37.300%	Swiss-Prot	Medium
`Q9LYL6`	Arabidopsis thaliana	sp\|Q9LYL6\|Y3270_ARATH WEB family protein At3g56270	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card