TkA01G556000 | RubberDandelionOmics

Gene overview

TkA01G556000

Reference: TK1151 Chr: Chr01 Coordinates: 139767838-139769647 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1622 bp · TkA01G556000|TK1151|cDNA

GAAACAGGAGAGCTCTTCCTCTAGATTATACTAGAATGTAAGATATACAATCACCGACTTACCGCCCTTGGAAAAAGCCTGCAACTCTCGCTCTCACTCTCACTCTCATTCCCACTCCCACTCCCACTCCCACTGTCACTCATTTCTCATACCTTGTAAGATCATCGTGTAGTGCGATACCTTTTCCGAGAGTCCAGTCCACCGCGGACACATGTAGAATCTGAATCCAGCAGTGATAACACATGCAAACACGCAATCGA...

CDS

Download CDS FASTA

666 bp · TkA01G556000|TK1151|CDS

ATGTCAGACCAAATCCCTTTCCATATTCAAGATGAAATCATGAAACGACTTCCAGTGAGATCACTGGTTCAGTTCCGATGCGTTTCAAAAGCATGGAAGTCTTTGATCGACAGTTCTGAGTTCATTGCCGCTCACAGCCTCCGCCGCCACACTCAGCCTCATTATCTGCTTCTATCATATGAAAATCCAGCAGAAGAGGAAGACTTAGTCTTCGTCTCCCGATGTTATACCGATGACGACACTTTCCCCCAACAATCGTC...

Protein

Download Protein FASTA

221 aa · TkA01G556000|TK1151|PROTEIN

MSDQIPFHIQDEIMKRLPVRSLVQFRCVSKAWKSLIDSSEFIAAHSLRRHTQPHYLLLSYENPAEEEDLVFVSRCYTDDDTFPQQSSVLTLPLWVEHLVFPSVIGSSQGLLCLYGYHLQFPTPMAVLWNPSIRKSVAVLTPDFGVCPNTGEPIEPSIGFGVCPVTNDPKIVANTSPSEFMIYKLSTRKWRRLPTNLPSRTQRFFSSVVTDRVIDLSIGKLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G556000`
TK1151 ID	TkA01G556000
OH-1004 ID	LXL04_001195
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 96.380 / OH-1004 57.105 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G556000

Location Chr01:139767838-139769647 (+)

Description Similar to At1g47730: Putative F-box protein At1g47730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At1g30790`	F-box protein At1g30790.	No verified direct reference in this release
`At1g15015`	F-box protein At1g15015.	No verified direct reference in this release
`At5g18160`	F-box protein At5g18160.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001195 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT3G10240

ath:AT4G12560

ath:AT5G10340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.601

Rank 1 · TkA01G556000 · TK1151

Nucleus0.430

Rank 2 · TkA01G556000 · TK1151

Cell membrane0.103

Rank 3 · TkA01G556000 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA01G556000 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA01G556000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box4-41 aa

PF12937F-box-like4-38 aa

PF24981Beta-prop_ATRN-LZTR119-47 aa

PF12249AftA_C30-100 aa

PF00646F-box169-197 aa

PF24981Beta-prop_ATRN-LZTR1177-209 aa

PF12937F-box-like187-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G556000	`PF00646`	F-box	4	41	2.8e-11	43.5
TkA01G556000	`PF12937`	F-box-like	4	38	0.00027	21.3
TkA01G556000	`PF24981`	Beta-prop_ATRN-LZTR1	19	47	0.056	13.4
TkA01G556000	`PF12249`	AftA_C	30	100	0.2	12.1
TkA01G556000	`PF00646`	F-box	169	197	2.8e-11	43.5
TkA01G556000	`PF24981`	Beta-prop_ATRN-LZTR1	177	209	0.056	13.4
TkA01G556000	`PF12937`	F-box-like	187	192	0.00027	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	28.500%	Swiss-Prot	Low
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	25.900%	Swiss-Prot	Low
`Q9SY20`	Arabidopsis thaliana	sp\|Q9SY20\|FB20_ARATH F-box protein At1g30790	34.100%	Swiss-Prot	Low
`Q9M9Q4`	Arabidopsis thaliana	sp\|Q9M9Q4\|FB9_ARATH F-box protein At1g15015	30.900%	Swiss-Prot	Low
`Q9FK54`	Arabidopsis thaliana	sp\|Q9FK54\|FB260_ARATH F-box protein At5g18160	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card