TkA01G555990 | RubberDandelionOmics

Gene overview

TkA01G555990

Reference: TK1151 Chr: Chr01 Coordinates: 139765640-139767167 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA01G555990|TK1151|cDNA

ATGATTCTTTCGTTTATGGATAGCAAAAGTCAAGGAGCAAGGAGGCTTTTATGGCTAAATTTAGCCAAGCCAAGTCTCCAAAGGGCTGGTGCTTCCGGTACTCGAGCGAGAGCGACTTGGTGTCAAAGTGAAGGAAGAATTGGTATTACGCGTGATTGGATTATCAAAGACTATTCCAATTGTGAGGTCATTGGAAGGGCAACAAGCAAGTGGTTTATGATGAATGAAGATACTAGAAGACTCCAGAAATTCAACAATGA...

CDS

Download CDS FASTA

345 bp · TkA01G555990|TK1151|CDS

ATGATTCTTTCGTTTATGGATAGCAAAAGTCAAGGAGCAAGGAGGCTTTTATGGCTAAATTTAGCCAAGCCAAGTCTCCAAAGGGCTGGTGCTTCCGGTACTCGAGCGAGAGCGACTTGGTGTCAAAGTGAAGGAAGAATTGGTATTACGCGTGATTGGATTATCAAAGACTATTCCAATTGTGAGGTCATTGGAAGGGCAACAAGCAAGTGGTTTATGATGAATGAAGATACTAGAAGACTCCAGAAATTCAACAATGA...

Protein

Download Protein FASTA

114 aa · TkA01G555990|TK1151|PROTEIN

MILSFMDSKSQGARRLLWLNLAKPSLQRAGASGTRARATWCQSEGRIGITRDWIIKDYSNCEVIGRATSKWFMMNEDTRRLQKFNNDVRDEYLIFCPNTSRLAFPEQNNSSLKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G555990`
TK1151 ID	TkA01G555990
OH-1004 ID	LXL04_001196
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.200
Protein coverage (%)	TK1151 100.000 / OH-1004 88.060 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G555990

Location Chr01:139765640-139767167 (+)

Description Similar to FATA: Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13050`	Plays an essential role in chain termination during de novo fatty acid synthesis.	Reduced expression of FatA thioesterases in Arabidopsis affects the oil content and fatty acid composition of the seeds.2012 · DOI: 10.1007/s00425-011-1534-5
`At3g25110`	Plays an essential role in chain termination during de novo fatty acid synthesis.	Characterization of substrate specificity of plant FatA and FatB acyl-ACP thioesterases.2002 · DOI: 10.1016/s0003-9861(02)00017-6 Reduced expression of FatA thioesterases in Arabidopsis affects the oil content and fatty acid composition of the seeds.2012 · DOI: 10.1007/s00425-011-1534-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001196 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0000036 acyl carrier activity Molecular Function

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G25110

ath:AT4G13050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.308

Rank 1 · TkA01G555990 · TK1151

Peroxisome0.242

Rank 2 · TkA01G555990 · TK1151

Nucleus0.155

Rank 3 · TkA01G555990 · TK1151

Mitochondrion0.152

Rank 4 · TkA01G555990 · TK1151

Plastid0.116

Rank 5 · TkA01G555990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01643Acyl-ACP_TE38-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G555990	`PF01643`	Acyl-ACP_TE	38	92	2.6e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV64`	Arabidopsis thaliana	sp\|Q9SV64\|FATA2_ARATH Oleoyl-acyl carrier protein thioesterase 2, chloroplastic	75.000%	Swiss-Prot	Medium
`Q42561`	Arabidopsis thaliana	sp\|Q42561\|FATA1_ARATH Oleoyl-acyl carrier protein thioesterase 1, chloroplastic	75.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card