TkA01G554590 | RubberDandelionOmics

Gene overview

TkA01G554590

Reference: TK1151 Chr: Chr01 Coordinates: 139489538-139491117 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1483 bp · TkA01G554590|TK1151|cDNA

AGCTCATACTTGATGTTTGCAATGCTTAGCCACGTTCCTGCAAGAGAAGCCTTTGCTAAAGATTTTCCGTCAATTCCTTTGATATTGTGCCAAGCAACGATACACTTGGCCCAAAGACTATTTTCCTCCGTTTTCAGCCTCCACACCCATTTAGTAAGCAGCGCCTACTAACTTTGTTAACTTTGTGAATTTGATAGTCATGGAAGTCCGCGTGAAATTGAACCTGAATCCAGCATCTGTGAAATAATCCACGCAATCGT...

CDS

Download CDS FASTA

597 bp · TkA01G554590|TK1151|CDS

ATGTCAGACCAATTCCATATTCAAGAGGAAATCATGAAACGACTTCCCGTGAAATCATTGGTTCAATTCAGATGCGTTTCAAAAGCATGGAAGTCTTTGATCGACAGCTCTGATTTTATTGCTGCTCACAGCCTCCGCCGCCACACTCAACCACATTATTTGCTTCTGTCAATTTGTGTATATCCACTCGACGTGTCCCGATGTTATACCGATGATGACACTTTCCCCCAACAAACGTCTGTTCCTACTCTCCCTCTATC...

Protein

Download Protein FASTA

198 aa · TkA01G554590|TK1151|PROTEIN

MSDQFHIQEEIMKRLPVKSLVQFRCVSKAWKSLIDSSDFIAAHSLRRHTQPHYLLLSICVYPLDVSRCYTDDDTFPQQTSVPTLPLSVKQLPCPFLVGSSQGLLCFLGSLLVFVSRTVVLWNPSIRKSIAVHVPDIGVGPFTFGFGVCPVTNDPKILAMIQLSEFMIYTLNTGKWRILSTNLPSKRTGGLFFSISQIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G554590`
TK1151 ID	TkA01G554590
OH-1004 ID	LXL04_001212
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.980 / OH-1004 43.016 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G554590

Location Chr01:139489538-139491117 (+)

Description Similar to At2g21930: F-box protein At2g21930

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At1g52495`	F-box protein At1g52495.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001212 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT1G50870

ath:AT2G21930

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · TkA01G554590 · TK1151

Nucleus0.422

Rank 2 · TkA01G554590 · TK1151

Cell membrane0.090

Rank 3 · TkA01G554590 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA01G554590 · TK1151

Mitochondrion0.039

Rank 5 · TkA01G554590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box6-39 aa

PF12937F-box-like10-36 aa

PF12937F-box-like51-66 aa

PF08268FBA_384-183 aa

PF07734FBA_1103-180 aa

PF00646F-box174-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G554590	`PF00646`	F-box	6	39	9.3e-10	38.7
TkA01G554590	`PF12937`	F-box-like	10	36	0.00065	20.1
TkA01G554590	`PF12937`	F-box-like	51	66	0.00065	20.1
TkA01G554590	`PF08268`	FBA_3	84	183	4.9e-05	23.2
TkA01G554590	`PF07734`	FBA_1	103	180	0.0046	16.7
TkA01G554590	`PF00646`	F-box	174	186	9.3e-10	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	27.400%	Swiss-Prot	Low
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	28.700%	Swiss-Prot	Low
`Q9SSQ2`	Arabidopsis thaliana	sp\|Q9SSQ2\|FB55_ARATH F-box protein At1g52495	28.600%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	26.500%	Swiss-Prot	Low
`Q9SXA0`	Arabidopsis thaliana	sp\|Q9SXA0\|FB42_ARATH Putative F-box protein At1g47730	25.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card