Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3105 bp · TkA01G554230|TK1151|cDNA
CTATAAATTACATTAAATGACCACAATTTCATTACCCTTTCACACACACACACCTTGGTCCTTGGGTGTGTGGTACAGAGAGAAGAATTAAAGCAGTGTGTAAACAAAAAGTCTATGCAAGTCAAGAATCTGGTATAACAAACATTCCCACCACCACCACCTACACAGTCTGCCACACCTGCTAATAAATACTCCGATACAACCAAAGAACACTTGGCCCAATAACATTCGGTCTCTCTTCCCAATATCCTCCAGAGAGA...
2622 bp · TkA01G554230|TK1151|CDS
ATGGGGGTAAGAAACTTGATGTTATGTGGATGCACCACCACCAAAAGTGCCGATGAATCGGAGCAGATGAAGAACAAGATCAAAGGAACTGTGGTTTTAATGAAGAAAAATGTACTTGATCTCAATGATTTCGGCGCATCGATTATCGACCGGGTTTATGACTTCTTCGGGAAACGTATCTCTATCAAACTTATCAGCGAGAATCATTTTGAATCATCGAATGGATCAAATGGGGAGATCGGAAAAGCAGCGGTTCTCGA...
Protein
Download Protein FASTA873 aa · TkA01G554230|TK1151|PROTEIN
MGVRNLMLCGCTTTKSADESEQMKNKIKGTVVLMKKNVLDLNDFGASIIDRVYDFFGKRISIKLISENHFESSNGSNGEIGKAAVLEDWVTKATPMAAGEASFSVTFEWEESMGVPGAFVIKNEHHSQFYLKTLTLERVPGHGVVRFVCNSWVYPAHRYKYERVFFANKAYLPCSTPEPLRRYREQELINLRGTGSGMLKRWDRVYDYAYYNDLGFPDKGPKYTRPVLGGSEEFPYPRRGRTGRKPTKTDPNSETRLCRL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G554230 |
|---|---|
| TK1151 ID | TkA01G554230 |
| OH-1004 ID | LXL04_001218 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G554230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:139362578-139371243 (+) | |||||||||
| Description | Similar to LOX1.5: Probable linoleate 9S-lipoxygenase 5 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006633 fatty acid biosynthetic process Biological Process GO:0006952 defense response Biological Process GO:0010311 lateral root formation Biological Process GO:0031408 oxylipin biosynthetic process Biological Process GO:0034440 lipid oxidation Biological Process GO:0048364 root development Biological Process GO:1900366 negative regulation of defense response to insect Biological Process GO:0005737 cytoplasm Cellular Component GO:0016165 linoleate 13S-lipoxygenase activity Molecular Function GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Molecular Function GO:0046872 metal ion binding Molecular Function GO:1990136 linoleate 9S-lipoxygenase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAB31252 ath:AT3G22400 sly:543994 sot:102577714 sot:102602528 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01477PLAT73-166 aaPF00305Lipoxygenase179-851 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G554230 | PF01477 | PLAT | 73 | 166 | 6.7e-18 | 66.2 |
| TkA01G554230 | PF00305 | Lipoxygenase | 179 | 851 | 1034.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.