TkA01G548010 | RubberDandelionOmics

Gene overview

TkA01G548010

Reference: TK1151 Chr: Chr01 Coordinates: 137670033-137671042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA01G548010|TK1151|cDNA

ATGGTTGAAGCCCTTGGTGAAATTGAAGTTGCATCAAAGTTGCTAAAGGAAACTGCAGGAATGGAAGACCGATTACTTTCACGTTATGAACGCCTTCATTGTGAACTAACACCAATAGAAGTTGACTCCGAAGAATTTCACATGATCAAGAAGTATACGAAGAACACTCATGCAAAGGCACATTCAAATTATATTGAAATCGTTCAGATTTTTAAAGCCTCAAGGCATGGAGAAGTTGATAGATTCAGCGAGTTCTCTAG...

CDS

Download CDS FASTA

504 bp · TkA01G548010|TK1151|CDS

ATGGTTGAAGCCCTTGGTGAAATTGAAGTTGCATCAAAGTTGCTAAAGGAAACTGCAGGAATGGAAGACCGATTACTTTCACGTTATGAACGCCTTCATTGTGAACTAACACCAATAGAAGTTGACTCCGAAGAATTTCACATGATCAAGAAGTATACGAAGAACACTCATGCAAAGGCACATTCAAATTATATTGAAATCGTTCAGATTTTTAAAGCCTCAAGGCATGGAGAAGTTGATAGATTCAGCGAGTTCTCTAG...

Protein

Download Protein FASTA

167 aa · TkA01G548010|TK1151|PROTEIN

MVEALGEIEVASKLLKETAGMEDRLLSRYERLHCELTPIEVDSEEFHMIKKYTKNTHAKAHSNYIEIVQIFKASRHGEVDRFSEFSSVKNRMLLWHGSRLTNWVGILSEGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCHASQHASHGVLLLCEVVHDFFIPYH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G548010`
TK1151 ID	TkA01G548010
OH-1004 ID	LXL04_001310
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 94.611 / OH-1004 25.723 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G548010

Location Chr01:137670033-137671042 (+)

Description Similar to PARP2: Poly [ADP-ribose] polymerase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02390`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0351200`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release
`Os01g0351100`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001310 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0030592 DNA ADP-ribosylation Biological Process

GO:0070212 protein poly-ADP-ribosylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003950 NAD+ poly-ADP-ribosyltransferase activity Molecular Function

GO:0016779 nucleotidyltransferase activity Molecular Function

GO:0140806 NAD+-protein-aspartate ADP-ribosyltransferase activity Molecular Function

GO:0140807 NAD+-protein-glutamate ADP-ribosyltransferase activity Molecular Function

GO:1990404 NAD+-protein mono-ADP-ribosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G02390

dosa:Os01g0351200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.557

Rank 1 · TkA01G548010 · TK1151

Nucleus0.539

Rank 2 · TkA01G548010 · TK1151

Endoplasmic reticulum0.044

Rank 3 · TkA01G548010 · TK1151

Golgi apparatus0.040

Rank 4 · TkA01G548010 · TK1151

Cell membrane0.037

Rank 5 · TkA01G548010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00644PARP43-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G548010	`PF00644`	PARP	43	158	3.3e-50	171.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q11207`	Arabidopsis thaliana	sp\|Q11207\|PARP2_ARATH Poly [ADP-ribose] polymerase 2	70.600%	Swiss-Prot	High
`Q5Z8Q9`	Oryza sativa subsp. japonica	sp\|Q5Z8Q9\|PRP2A_ORYSJ Poly [ADP-ribose] polymerase 2-A	68.800%	Swiss-Prot	High
`Q0JMY1`	Oryza sativa subsp. japonica	sp\|Q0JMY1\|PRP2B_ORYSJ Poly [ADP-ribose] polymerase 2-B	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card