TkA01G547240 | RubberDandelionOmics

Gene overview

TkA01G547240

Reference: TK1151 Chr: Chr01 Coordinates: 137449173-137450281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

449 bp · TkA01G547240|TK1151|cDNA

GAGGAATCAATTGTCGTCTCTCTCACACGCACGACACATCGAGTAAAAATTCAGTAATGGAAAACATCGGCCCCTTGATCAGAGGTTACCTCACGAAACTAAAGCAAGTATCGGTGTTATGGCTCGAAGGTTTTCGAGAAGCTTGCTGTCTTCACAGAGTCGTCATCTACTGTCTCAGGTCGAGGCAACTGATGATTCGCACTGGACAGTGCTTTCTATTAAACGGTTTAATCTTTCTAGGGAGTATTTTGATCCTAAGA...

CDS

Download CDS FASTA

393 bp · TkA01G547240|TK1151|CDS

ATGGAAAACATCGGCCCCTTGATCAGAGGTTACCTCACGAAACTAAAGCAAGTATCGGTGTTATGGCTCGAAGGTTTTCGAGAAGCTTGCTGTCTTCACAGAGTCGTCATCTACTGTCTCAGGTCGAGGCAACTGATGATTCGCACTGGACAGTGCTTTCTATTAAACGGTTTAATCTTTCTAGGGAGTATTTTGATCCTAAGATCTCTTATCATTCCAACACTACATTGGATATTGCCCTTTGAAGTCTCGGATGGTAA...

Protein

Download Protein FASTA

131 aa · TkA01G547240|TK1151|PROTEIN

MENIGPLIRGYLTKLKQVSVLWLEGFREACCLHRVVIYCLRSRQLMIRTGQCFLLNGLIFLGSILILRSLIIPTLHWILPFEVSDGNQDACSSQMPIRLYAFLRLGLLQLIYALWFYPLYIFSFILSTIWY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G547240`
TK1151 ID	TkA01G547240
OH-1004 ID	LXL04_001328
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 39.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G547240

Location Chr01:137449173-137450281 (+)

Description Similar to At4g06676: Protein EI24 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g06676`	Protein EI24 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001328 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006914 autophagy Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0016236 macroautophagy Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0042308 negative regulation of protein import into nucleus Biological Process

GO:0071494 cellular response to UV-C Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT4G06676

ddi:DDB_G0284253

hsa:9538

mmu:13663

rno:300514

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.521

Rank 1 · TkA01G547240 · TK1151

Nucleus0.218

Rank 2 · TkA01G547240 · TK1151

Cytoplasm0.130

Rank 3 · TkA01G547240 · TK1151

Golgi apparatus0.127

Rank 4 · TkA01G547240 · TK1151

Cell membrane0.087

Rank 5 · TkA01G547240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07264EI2431-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G547240	`PF07264`	EI24	31	131	0.00012	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5BPL5`	Arabidopsis thaliana	sp\|Q5BPL5\|EI24_ARATH Protein EI24 homolog	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card