TkA01G547220 | RubberDandelionOmics

Gene overview

TkA01G547220

Reference: TK1151 Chr: Chr01 Coordinates: 137443477-137445083 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1244 bp · TkA01G547220|TK1151|cDNA

AAAATCAGATATTTAAGATTAGTACAAAAATCATGGTGGGATCCTTGGAGGGCTATTTTGGGTGTTTCGTCTTCTTCGGGGCTCTCCAGAAATACCAAACACCACCTCTCAACCCTTGAACAAACGGCCCTAACAGAAACCCCTTTGTTAAAGTCTCGATCTGCGCCTACAACAAGTATTTTCCGGCGAAGAAATTTTAACGGATTATCGTTGCCGTAGATTCGAGAAAGAATCGCGAAGATGCAAACTGCTGCTGTGAT...

CDS

Download CDS FASTA

306 bp · TkA01G547220|TK1151|CDS

ATGAAACTAGGGATTGAAAGACGCTTGATGGAGAAAATTCCCGAAATTGTTGCTGTTGAACCAATACCAGACGAAGAAACTGGGCTTGAACTCAATGAAGAAAACATAGAGAAGGTTCTAGAAGAAATACGACCGTATCTTGTTGGAGCGGCGGGTGGATCCGTGGAGCTTGTGTCGATTGAAGAGCCGATTGTAAAAGTACGGTTAACGGGTCCCGCAGCAAGTGTGATGACTGTTAGAGTAGCTTTGACTCAGAAACT...

Protein

Download Protein FASTA

101 aa · TkA01G547220|TK1151|PROTEIN

MKLGIERRLMEKIPEIVAVEPIPDEETGLELNEENIEKVLEEIRPYLVGAAGGSVELVSIEEPIVKVRLTGPAASVMTVRVALTQKLREKIPAIAAVQLLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G547220`
TK1151 ID	TkA01G547220
OH-1004 ID	LXL04_001329
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 41.736 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G547220

Location Chr01:137443477-137445083 (+)

Description Similar to NIFU2: NifU-like protein 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At4g25910`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0176200`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001329 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G01940

ath:AT4G25910

ath:AT5G49940

dosa:Os12g0176200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · TkA01G547220 · TK1151

Nucleus0.381

Rank 2 · TkA01G547220 · TK1151

Mitochondrion0.124

Rank 3 · TkA01G547220 · TK1151

Cell membrane0.110

Rank 4 · TkA01G547220 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA01G547220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01106NifU1-20 aa

PF01968Hydantoinase_A32-82 aa

PF01106NifU36-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G547220	`PF01106`	NifU	1	20	4.6e-17	62.6
TkA01G547220	`PF01968`	Hydantoinase_A	32	82	0.052	13.5
TkA01G547220	`PF01106`	NifU	36	97	4.6e-17	62.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W20`	Arabidopsis thaliana	sp\|Q93W20\|NIFU2_ARATH NifU-like protein 2, chloroplastic	84.000%	Swiss-Prot	High
`Q84RQ7`	Arabidopsis thaliana	sp\|Q84RQ7\|NIFU3_ARATH NifU-like protein 3, chloroplastic	69.600%	Swiss-Prot	High
`Q84LK7`	Oryza sativa subsp. japonica	sp\|Q84LK7\|NIFU1_ORYSJ NifU-like protein 1, chloroplastic	70.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card