TkA01G544460 | RubberDandelionOmics

Gene overview

TkA01G544460

Reference: TK1151 Chr: Chr01 Coordinates: 136598281-136601913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · TkA01G544460|TK1151|cDNA

ATGGCGCGTGATTGTGATGTGAAAGATTTGTCCGGGGTTGAATGCTTCTCGTGCCATGAAATGGGACACTTTAGCAGTAAATGCCCGAACGAAAAGGAGAAGGATCAAGGGCTACGGGTGAGAAGAAGAAGGAAGCACGAAGAAAGGAAAGGGTTTTCAAATGACCTTGGCGGAGGCCAAGGAGACGGAGGACGTGGTGGCAGGCTGCGAGCCGACGCGGGCACCTTACCGTCTTGCTCCTACCGAGATGAGGGGAACTT...

CDS

Download CDS FASTA

1554 bp · TkA01G544460|TK1151|CDS

ATGGCGCGTGATTGTGATGTGAAAGATTTGTCCGGGGTTGAATGCTTCTCGTGCCATGAAATGGGACACTTTAGCAGTAAATGCCCGAACGAAAAGGAGAAGGATCAAGGGCTACGGGTGAGAAGAAGAAGGAAGCACGAAGAAAGGAAAGGGTTTTCAAATGACCTTGGCGGAGGCCAAGGAGACGGAGGACGTGGTGGCAGGCTGCGAGCCGACGCGGGCACCTTACCGTCTTGCTCCTACCGAGATGAGGGGAACTT...

Protein

Download Protein FASTA

517 aa · TkA01G544460|TK1151|PROTEIN

MARDCDVKDLSGVECFSCHEMGHFSSKCPNEKEKDQGLRVRRRRKHEERKGFSNDLGGGQGDGGRGGRLRADAGTLPSCSYRDEGNLWHNSKNPRQGVLSVRVRPLGCDGRSREDRDGDEVRNPRKLSSEVRSFLGLAGYYRRFIEGFSKIAVLLLNLPRKKRNLSGNEKRQEAFETLRKKLCEAPVLTLPEGTEDFVVFSDASSHGLGCVLMQRGKVIAYASRQLKDAETRYPTHDLELAAIVHALKMWRHYLKTNVVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G544460`
TK1151 ID	TkA01G544460
OH-1004 ID	LXL04_014154
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	53.700
Protein coverage (%)	TK1151 76.209 / OH-1004 17.874 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G544460`
Location	Chr01:136598281-136601913 (-)
Description	Similar to DPEP: 4-alpha-glucanotransferase, chloroplastic/amyloplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014154` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000025 maltose catabolic process Biological Process GO:0000272 polysaccharide catabolic process Biological Process GO:0005983 starch catabolic process Biological Process GO:0006006 glucose metabolic process Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009501 amyloplast Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT5G64860 dosa:Os07g0627000 sce:YIL082W-A sot:102595076 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561

Rank 1 · TkA01G544460 · TK1151

Nucleus0.320

Rank 2 · TkA01G544460 · TK1151

Mitochondrion0.103

Rank 3 · TkA01G544460 · TK1151

Cell membrane0.038

Rank 4 · TkA01G544460 · TK1151

Peroxisome0.037

Rank 5 · TkA01G544460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00098zf-CCHC1-6 aa

PF00098zf-CCHC14-30 aa

PF17919RT_RNaseH_2169-256 aa

PF17917RT_RNaseH194-256 aa

PF04695Pex14_N297-313 aa

PF16508NIBRIN_BRCT_II382-472 aa

PF00385Chromo458-506 aa

PF04695Pex14_N466-479 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G544460	`PF00098`	zf-CCHC	1	6	0.0063	17.3
TkA01G544460	`PF00098`	zf-CCHC	14	30	0.0063	17.3
TkA01G544460	`PF17919`	RT_RNaseH_2	169	256	9.7e-29	100.1
TkA01G544460	`PF17917`	RT_RNaseH	194	256	3.7e-20	72.8
TkA01G544460	`PF04695`	Pex14_N	297	313	0.25	11.7
TkA01G544460	`PF16508`	NIBRIN_BRCT_II	382	472	0.21	12.6
TkA01G544460	`PF00385`	Chromo	458	506	0.046	14.4
TkA01G544460	`PF04695`	Pex14_N	466	479	0.25	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card