TkA01G543940 | RubberDandelionOmics

Gene overview

TkA01G543940

Reference: TK1151 Chr: Chr01 Coordinates: 136444882-136446612 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1476 bp · TkA01G543940|TK1151|cDNA

CACCAACTCTCCGATCTAAATCTCCATTGTAGAAGGAATCCACACTTGACATTTTCCATAAATATATTTTGGCAAGTTTTACATTTTTGACTTCAAAAGGAAACATGGAGATGAAATTGGTGGCAGAGGCGGCGGACCAGACGGTGTATGAGGGTGAAGGGGGAGGTTACTATTCCTGGTCAACTTCCAAATCTCCATTGTTGCAGGATTTAAAGCTTGGTGCCGGCAAGCTTCTCCTCCACCCTCATGGATTCGCTCTT...

CDS

Download CDS FASTA

1083 bp · TkA01G543940|TK1151|CDS

ATGGAGATGAAATTGGTGGCAGAGGCGGCGGACCAGACGGTGTATGAGGGTGAAGGGGGAGGTTACTATTCCTGGTCAACTTCCAAATCTCCATTGTTGCAGGATTTAAAGCTTGGTGCCGGCAAGCTTCTCCTCCACCCTCATGGATTCGCTCTTCCTCACTATGCCGATTCCTCCAAAATCGGTTATGTTCTTGAAGGTGTGTGCACGGTTGGATTGGTGGCGCCGAACAGTTCCCAAGAAACCGTCGTAGTGATCAA...

Protein

Download Protein FASTA

360 aa · TkA01G543940|TK1151|PROTEIN

MEMKLVAEAADQTVYEGEGGGYYSWSTSKSPLLQDLKLGAGKLLLHPHGFALPHYADSSKIGYVLEGVCTVGLVAPNSSQETVVVIKKGDVIPLQRGVVSWWFNGGETDLTIVFIGETTIAQIPGQFTYYFMAGVLGILRGFQSDVVAKVFGLTNQESEDIATSQPGVVIVKLGDGIVFPNASKYVKEKLYATIDTPKADVVVKGGGTINSLTGKDFPMVVEMGLSARFVRLECEAILAPSYVADGSIQVIYVAKGSGRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G543940`
TK1151 ID	TkA01G543940
OH-1004 ID	LXL04_001358
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 85.556 / OH-1004 80.840 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G543940`
Location	Chr01:136444882-136446612 (+)
Description	Similar to GLUD1: Glutelin type-D 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001358` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010431 seed maturation Biological Process GO:0048316 seed development Biological Process GO:0000326 protein storage vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005773 vacuole Cellular Component GO:0043245 extraorganismal space Cellular Component GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	ath:AT1G03890 dosa:Os02g0249000 dosa:Os10g0400200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.347

Rank 1 · TkA01G543940 · TK1151

Lysosome / Vacuole0.249

Rank 2 · TkA01G543940 · TK1151

Cytoplasm0.195

Rank 3 · TkA01G543940 · TK1151

Endoplasmic reticulum0.155

Rank 4 · TkA01G543940 · TK1151

Nucleus0.055

Rank 5 · TkA01G543940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_112-157 aa

PF07883Cupin_245-115 aa

PF00027cNMP_binding60-126 aa

PF05899Cupin_361-102 aa

PF07883Cupin_2169-180 aa

PF05899Cupin_3169-183 aa

PF00190Cupin_1195-338 aa

PF07883Cupin_2202-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G543940	`PF00190`	Cupin_1	12	157	2.7e-41	141.4
TkA01G543940	`PF07883`	Cupin_2	45	115	1.1e-05	25.8
TkA01G543940	`PF00027`	cNMP_binding	60	126	0.16	12.7
TkA01G543940	`PF05899`	Cupin_3	61	102	0.22	12.0
TkA01G543940	`PF07883`	Cupin_2	169	180	1.1e-05	25.8
TkA01G543940	`PF05899`	Cupin_3	169	183	0.22	12.0
TkA01G543940	`PF00190`	Cupin_1	195	338	2.7e-41	141.4
TkA01G543940	`PF07883`	Cupin_2	202	218	1.1e-05	25.8
TkA01G543940	`PF07883`	Cupin_2	245	284	1.1e-05	25.8
TkA01G543940	`PF00027`	cNMP_binding	251	287	0.16	12.7
TkA01G543940	`PF05899`	Cupin_3	257	287	0.22	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card