TkA01G539620 | RubberDandelionOmics

Gene overview

TkA01G539620

Reference: TK1151 Chr: Chr01 Coordinates: 135303893-135306640 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1506 bp · TkA01G539620|TK1151|cDNA

GCCCTCCTTGCGATATGAAAATAACAAAACGGGGTGTCTTGTGTTTTGAAGAACGGATCCCACCACGCACATGGAACCGCAACCCTCCCGCAAGCGACCGCTCCCCGACAACGACGACGCTGGAGATGCTGATGAGCTCAACCGAAAACCTCCGCAAAAGAAAGTGAGGTTTCCAAAGGGAAGGAAGGTGAAGTCTGGAGATGAAGTGGTGGCACCTGCACCATTACCCCAAATTGCTGAAGATGAACCTACTGAGTTAC...

CDS

Download CDS FASTA

1269 bp · TkA01G539620|TK1151|CDS

ATGAAAATAACAAAACGGGGTGTCTTGTGTTTTGAAGAACGGATCCCACCACGCACATGGAACCGCAACCCTCCCGCAAGCGACCGCTCCCCGACAACGACGACGCTGGAGATGCTGATGAGCTCAACCGAAAACCTCCGTTCTCGTATCTCCAATTTGGGCCTTCAAATGCTTGTTTTTGGTAATAAGTTAACTAGGCAAAAGAAAGTGAGGTTTCCAAAGGGAAGGAAGGTGAAGTCTGGAGATGAAGTGGTGGCACC...

Protein

Download Protein FASTA

422 aa · TkA01G539620|TK1151|PROTEIN

MKITKRGVLCFEERIPPRTWNRNPPASDRSPTTTTLEMLMSSTENLRSRISNLGLQMLVFGNKLTRQKKVRFPKGRKVKSGDEVVAPAPLPQIAEDEPTELQDTQLVAKARSKRRNQDKAGLNIDENGDLLDVVAAAEMHYENNETLEDDGVQLEPFNLEQERKEGFFDKTGNYVEYVTNDIKDAWLDSIDADPNLAKIHSTSTNDVVEAADLSSQDIGTIKRRIADVLQPGETVLQALRRLKGSSNRKEKMSAGTKVVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G539620`
TK1151 ID	TkA01G539620
OH-1004 ID	LXL04_001408
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 85.545 / OH-1004 94.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G539620`
Location	Chr01:135303893-135306640 (-)
Description	Similar to SUA: SUPPRESSOR OF ABI3-5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001408` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0001650 fibrillar center Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005682 U5 snRNP Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT3G54230 dme:Dmel_CG5198 hsa:10421 mmu:70233 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA01G539620 · TK1151

Cytoplasm0.282

Rank 2 · TkA01G539620 · TK1151

Cell membrane0.030

Rank 3 · TkA01G539620 · TK1151

Mitochondrion0.027

Rank 4 · TkA01G539620 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA01G539620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18705DUF564330-44 aa

PF17780OCRE167-177 aa

PF27461TraD_C229-241 aa

PF18705DUF5643254-296 aa

PF18705DUF5643330-369 aa

PF17780OCRE364-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G539620	`PF18705`	DUF5643	30	44	7.3	7.3
TkA01G539620	`PF17780`	OCRE	167	177	5.8e-18	65.4
TkA01G539620	`PF27461`	TraD_C	229	241	0.0069	16.8
TkA01G539620	`PF18705`	DUF5643	254	296	7.3	7.3
TkA01G539620	`PF18705`	DUF5643	330	369	7.3	7.3
TkA01G539620	`PF17780`	OCRE	364	412	5.8e-18	65.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card