Gene Card
Gene overview
cDNA / CDS / Protein Sequences
552 bp · TkA01G536910|TK1151|cDNA
ATGTATCGTGAAACAGGGGATATTTGCGACATGGGTCCTTTTAAAAGATTGATTTTGTTGCCGCTTAATGTTAAGGTAGTTAGCCATAGCCATAGCCAGCCGTCATCTGGGGGAATCTTGAGTTCCATTACTTATGGAGCCAATGAGATCGCGTGTTCTGTTCGTGCAAGTATCACAAGTCAGACTAAGAAAAACAGAGGGAGTCGAGTCAGTTCGGATCTTGATAAAGGGATAGGAGAGCCGTCTTCGTCTTCATCTAC...
552 bp · TkA01G536910|TK1151|CDS
ATGTATCGTGAAACAGGGGATATTTGCGACATGGGTCCTTTTAAAAGATTGATTTTGTTGCCGCTTAATGTTAAGGTAGTTAGCCATAGCCATAGCCAGCCGTCATCTGGGGGAATCTTGAGTTCCATTACTTATGGAGCCAATGAGATCGCGTGTTCTGTTCGTGCAAGTATCACAAGTCAGACTAAGAAAAACAGAGGGAGTCGAGTCAGTTCGGATCTTGATAAAGGGATAGGAGAGCCGTCTTCGTCTTCATCTAC...
Protein
Download Protein FASTA183 aa · TkA01G536910|TK1151|PROTEIN
MYRETGDICDMGPFKRLILLPLNVKVVSHSHSQPSSGGILSSITYGANEIACSVRASITSQTKKNRGSRVSSDLDKGIGEPSSSSSTETTQDGSNVKDDGGGDSDMVNRKLTFRKDQRDESQMVHMYELINLPPDARPLLVFINKKSGAKRGDSIRLRMNILLNPVQVQNDSILHLSVDVYYT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G536910 |
|---|---|
| TK1151 ID | TkA01G536910 |
| OH-1004 ID | LXL04_001430 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 63.986Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G536910 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:134677364-134677915 (-) | |||||||||
| Description | Similar to DGK1: Diacylglycerol kinase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process GO:0009409 response to cold Biological Process GO:0009611 response to wounding Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0046486 glycerolipid metabolic process Biological Process GO:0048364 root development Biological Process GO:0048366 leaf development Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0016020 membrane Cellular Component GO:0004143 ATP-dependent diacylglycerol kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G07920 ath:AT5G63770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.