Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3082 bp · TkA01G533790|TK1151|cDNA
CTAAAATATGTCAATCTCACACCCTATAAAATGGAAAGTTTCACTTTATTCCCTTATGCTTAGGCGGCACCAGAATCTTCCCCATCTCTCCCTAAATTATTTGCAACACAAATCACGTTCTCTCCACCTCCCTCGTACCTCTAGGGTTTCACACACTGAAATTGATCTCACAACCAAATCCAGTTCGATGGCGGACGAACCAGTAGTCCCTTCGTCGCCTCAACAAACGCCATCTTCATCTTCGTCCAACTCCAACGCCG...
2661 bp · TkA01G533790|TK1151|CDS
ATGTCAATCTCACACCCTATAAAATGGAAAGTTTCACTTTATTCCCTTATGCTTAGGCGGCACCAGAATCTTCCCCATCTCTCCCTAAATTATTTGCAACACAAATCACGTTCTCTCCACCTCCCTCGTACCTCTAGGGTTTCACACACTGAAATTGATCTCACAACCAAATCCAGTTCGATGGCGGACGAACCAGTAGTCCCTTCGTCGCCTCAACAAACGCCATCTTCATCTTCGTCCAACTCCAACGCCGCTCCTCT...
Protein
Download Protein FASTA886 aa · TkA01G533790|TK1151|PROTEIN
MSISHPIKWKVSLYSLMLRRHQNLPHLSLNYLQHKSRSLHLPRTSRVSHTEIDLTTKSSSMADEPVVPSSPQQTPSSSSSNSNAAPLGHNVIPIVNKLQDIFAQLGSSSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGTDEEYGEFLHVPGKRFYNFNEIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIRLPSCLI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G533790 |
|---|---|
| TK1151 ID | TkA01G533790 |
| OH-1004 ID | LXL04_001462 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G533790 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:133957387-133962346 (+) | |||||||||
| Description | Similar to DRP3A: Dynamin-related protein 3A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000001 mitochondrion inheritance Biological Process GO:0000266 mitochondrial fission Biological Process GO:0006897 endocytosis Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007031 peroxisome organization Biological Process GO:0015886 heme transport Biological Process GO:0016050 vesicle organization Biological Process GO:0016236 macroautophagy Biological Process GO:0016559 peroxisome fission Biological Process GO:0044375 regulation of peroxisome size Biological Process GO:0048312 intracellular distribution of mitochondria Biological Process GO:0048511 rhythmic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G14120 ath:AT4G33650 bta:540892 hsa:10059 sce:YLL001W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13191AAA_1696-134 aaPF25683URGCP_GTPase109-151 aaPF01926MMR_HSR1115-234 aaPF00350Dynamin_N116-296 aaPF13304AAA_21117-133 aaPF01031Dynamin_M304-590 aaPF00350Dynamin_N370-440 aaPF02212GED718-808 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G533790 | PF13191 | AAA_16 | 96 | 134 | 0.057 | 14.6 |
| TkA01G533790 | PF25683 | URGCP_GTPase | 109 | 151 | 0.023 | 14.2 |
| TkA01G533790 | PF01926 | MMR_HSR1 | 115 | 234 | 9.4e-05 | 23.2 |
| TkA01G533790 | PF00350 | Dynamin_N | 116 | 296 | 6.4e-55 | 186.4 |
| TkA01G533790 | PF13304 | AAA_21 | 117 | 133 | 0.16 | 12.6 |
| TkA01G533790 | PF01031 | Dynamin_M | 304 | 590 | 1.5e-105 | 353.3 |
| TkA01G533790 | PF00350 | Dynamin_N | 370 | 440 | 6.4e-55 | 186.4 |
| TkA01G533790 | PF02212 | GED | 718 | 808 | 3.1e-28 | 98.5 |
| TkA01G533790 | PF13191 | AAA_16 | 760 | 793 | 0.057 | 14.6 |
| TkA01G533790 | PF13304 | AAA_21 | 795 | 872 | 0.16 | 12.6 |
| TkA01G533790 | PF01926 | MMR_HSR1 | 797 | 832 | 9.4e-05 | 23.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.