TkA01G533380 | RubberDandelionOmics

Gene overview

TkA01G533380

Reference: TK1151 Chr: Chr01 Coordinates: 133872275-133875572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1835 bp · TkA01G533380|TK1151|cDNA

GAAATTTAAGTAATTCCTAAATTTAGTAAGTTAACTCTTCTAAATTGAATCGGTCCTCTTCCCGGTTGAGTCGATCCCCTTTCCTCCCTATCGCACTAACGAACGAACTTGTCGCTATATCGGTCGATTAGCCGTATCTTCCGCCTACGAATCACCTATCGCGCTAACTAACATCTCATTCTCTTGATTTCTAGGTCGGAGTTTTTATCAATAACCATAGCCATCCTCACGAGTTCAGGGACTCGGAAGGTGGAATCGGA...

CDS

Download CDS FASTA

573 bp · TkA01G533380|TK1151|CDS

ATGTATGCCTTATTTCAAACACAACATTGTAATTATTCGCATACTACGCCCTACACCTGTTCCTTTAACTATTCTGGAGAAGTCATTGATGAGGAAGATATGTATTTCCTTGATGCGGACAAGGAGAATGATGATGATGATGATGATGATGATGATGTTGATGAAAATGATGATGCAGATCTTGAAAAAAGGCCCTTTAAAACAAAAAGGGTGACAAGAGTGGTTTTGAATAAAAGGATTAGAAATAAAGAAACGATGAA...

Protein

Download Protein FASTA

190 aa · TkA01G533380|TK1151|PROTEIN

MYALFQTQHCNYSHTTPYTCSFNYSGEVIDEEDMYFLDADKENDDDDDDDDDVDENDDADLEKRPFKTKRVTRVVLNKRIRNKETMKVQAEAKKTMKFDKEHNSLPAIINEIAKEDEEKSKRHERRVIAKQERLKSCPPRLGRQKFEPAPVQVLLYEDITGSLRKLKACCTLARDRYKESSEKRNNCPYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G533380`
TK1151 ID	TkA01G533380
OH-1004 ID	LXL04_023730
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.800
Protein coverage (%)	TK1151 93.684 / OH-1004 42.105 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G533380

Location Chr01:133872275-133875572 (+)

Description Similar to At2g40430: Ribosome biogenesis protein NOP53

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40430`	May play a role in ribosome biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023730 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0006364 rRNA processing Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0008097 5S rRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G40430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.705

Rank 1 · TkA01G533380 · TK1151

Cytoplasm0.286

Rank 2 · TkA01G533380 · TK1151

Mitochondrion0.042

Rank 3 · TkA01G533380 · TK1151

Cell membrane0.031

Rank 4 · TkA01G533380 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA01G533380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08158SDA1_HEAT28-101 aa

PF05764YL131-127 aa

PF07767Nop5336-178 aa

PF02724CDC4539-125 aa

PF11801Tom37_C48-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G533380	`PF08158`	SDA1_HEAT	28	101	0.12	12.0
TkA01G533380	`PF05764`	YL1	31	127	0.0033	18.3
TkA01G533380	`PF07767`	Nop53	36	178	1.2e-21	78.2
TkA01G533380	`PF02724`	CDC45	39	125	0.35	9.8
TkA01G533380	`PF11801`	Tom37_C	48	155	0.11	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22892`	Arabidopsis thaliana	sp\|O22892\|NOP53_ARATH Ribosome biogenesis protein NOP53	66.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card