Gene Card
Gene overview
cDNA / CDS / Protein Sequences
573 bp · TkA01G533120|TK1151|cDNA
ATGGTTGATGAACTAAATTCAAGCAAGGATCATACAGTCAAGGTCAGAATTCTCCGAGTGTGGAAAAATTATTCATGGGATAATAAACAAGAAATTCGTAGCATTTCAATGATTTTAATGGATCAGAAGGGTTCTAAGATAGAATGTAATGTAAACAAATCATATTATACTCCCTATTTGAAACTATTTGAAGAATATGCTGTGGTGTATATTCGAAACTCTACGGTTGGCAAACATTTAGGCAAGATTAAATATGTTGA...
573 bp · TkA01G533120|TK1151|CDS
ATGGTTGATGAACTAAATTCAAGCAAGGATCATACAGTCAAGGTCAGAATTCTCCGAGTGTGGAAAAATTATTCATGGGATAATAAACAAGAAATTCGTAGCATTTCAATGATTTTAATGGATCAGAAGGGTTCTAAGATAGAATGTAATGTAAACAAATCATATTATACTCCCTATTTGAAACTATTTGAAGAATATGCTGTGGTGTATATTCGAAACTCTACGGTTGGCAAACATTTAGGCAAGATTAAATATGTTGA...
Protein
Download Protein FASTA190 aa · TkA01G533120|TK1151|PROTEIN
MVDELNSSKDHTVKVRILRVWKNYSWDNKQEIRSISMILMDQKGSKIECNVNKSYYTPYLKLFEEYAVVYIRNSTVGKHLGKIKYVDHEKQMYFKQDTTVTKCNDFDGPTYGFRFAKFQEILDNSHPCDSSLDVIGKVVDMEPSEKNKGFNKDTLQQNLYLEDLRYSYIFITYNGNNKLLIQCIFYIKFI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G533120 |
|---|---|
| TK1151 ID | TkA01G533120 |
| OH-1004 ID | LXL04_030169 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.000 |
| Protein coverage (%) | TK1151 86.316 / OH-1004 33.131Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G533120 |
|---|---|
| Location | Chr01:133806429-133807190 (-) |
| Description | Similar to RPA1A: Replication protein A 70 kDa DNA-binding subunit A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006298 mismatch repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006974 DNA damage response Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007131 reciprocal meiotic recombination Biological Process |
| KEGG gene cross-reference | ath:AT2G06510 ath:AT5G08020 dosa:Os02g0776800 hsa:6117 pon:100173266 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02721DUF22312-123 aaPF28721DUF844833-53 aaPF28721DUF8448117-172 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G533120 | PF02721 | DUF223 | 12 | 123 | 8e-20 | 71.9 |
| TkA01G533120 | PF28721 | DUF8448 | 33 | 53 | 0.15 | 12.8 |
| TkA01G533120 | PF28721 | DUF8448 | 117 | 172 | 0.15 | 12.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.