TkA01G528720 | RubberDandelionOmics

Gene overview

TkA01G528720

Reference: TK1151 Chr: Chr01 Coordinates: 132717005-132717753 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

584 bp · TkA01G528720|TK1151|cDNA

AGGACCCTTCATCTGTAGTTTACATAGCGTTTGGAAGTCATGTCATCTTGAATGAAGAACAGTTGACTGAGATGGCTTACGGCGTTTTAAATTCCGGTATGTCGTTTTTGTGGGTCATGAAGAGCAGGTTGCCGGAGGAGTTCTTGGAGGCGGTGGGTGGGAGAGGAATGGTGGTTAACTGGAGTCCACAACCTCAGGTATTGTCCCACCCGGCGGTGTCTTGTTTTGTGACTCACTGTGGGTGGAACTCGACAATTGAG...

CDS

Download CDS FASTA

513 bp · TkA01G528720|TK1151|CDS

ATGGCTTACGGCGTTTTAAATTCCGGTATGTCGTTTTTGTGGGTCATGAAGAGCAGGTTGCCGGAGGAGTTCTTGGAGGCGGTGGGTGGGAGAGGAATGGTGGTTAACTGGAGTCCACAACCTCAGGTATTGTCCCACCCGGCGGTGTCTTGTTTTGTGACTCACTGTGGGTGGAACTCGACAATTGAGGCATTGTCGAGCGGTGTTCCGGTGGTGGCGTTCCCGCAGTATGGAGATCAGGTGACGAATGCTAGATATTT...

Protein

Download Protein FASTA

171 aa · TkA01G528720|TK1151|PROTEIN

MAYGVLNSGMSFLWVMKSRLPEEFLEAVGGRGMVVNWSPQPQVLSHPAVSCFVTHCGWNSTIEALSSGVPVVAFPQYGDQVTNARYLVDEWKVGIGMRRRGEPEKKLIGRKEVEECLREVTCGVKAAEMKENALKWKKLAEAAVAIDHHPRVRCSIRLGVRAPNAVEDASL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G528720`
TK1151 ID	TkA01G528720
OH-1004 ID	LXL04_001520
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.300
Protein coverage (%)	TK1151 85.380 / OH-1004 30.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G528720`
Location	Chr01:132717005-132717753 (-)
Description	Similar to UGT84A13: Gallate 1-beta-glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001520` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0009801 cinnamic acid ester metabolic process Biological Process GO:0033494 ferulate metabolic process Biological Process GO:0046278 3,4-dihydroxybenzoate metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0047250 4-hydroxybenzoate 4-O-beta-D-glucosyltransferase activity Molecular Function GO:0047891 flavone 7-O-beta-glucosyltransferase activity Molecular Function GO:0047913 gallate 1-beta-glucosyltransferase activity Molecular Function GO:0050004 isoflavone 7-O-glucosyltransferase activity Molecular Function GO:0050284 sinapate 1-glucosyltransferase activity Molecular Function GO:0050412 cinnamate beta-D-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AHA54051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.403

Rank 1 · TkA01G528720 · TK1151

Cytoplasm0.352

Rank 2 · TkA01G528720 · TK1151

Nucleus0.116

Rank 3 · TkA01G528720 · TK1151

Mitochondrion0.089

Rank 4 · TkA01G528720 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA01G528720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT2-92 aa

PF06722EryCIII-like_C34-135 aa

PF04101Glyco_tran_28_C51-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G528720	`PF00201`	UDPGT	2	92	5.9e-21	75.6
TkA01G528720	`PF06722`	EryCIII-like_C	34	135	4.9e-06	27.3
TkA01G528720	`PF04101`	Glyco_tran_28_C	51	121	0.0059	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card