TkA01G528680 | RubberDandelionOmics

Gene overview

TkA01G528680

Reference: TK1151 Chr: Chr01 Coordinates: 132700757-132703091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

917 bp · TkA01G528680|TK1151|cDNA

AAATCAAACAAAAAAAAAAAAAAAAAAGACCGGTCGCCTGTGGACACCTTGACTGCTTCACATCGTCTTCTTCGATTCCGGCCGCAGTCGGCGAGTCCGCCACCGCCACAGCCAACGCCGGCGAGCCTCTCTCCGCTACAGCAGCACACAACAGCAGTTTGATTTTCGATTCCGCCACAGCAGACTTCGTTTTCTTCTCTCCATTTCAAGATGGCTTCATCTGGGGGAGAGGAAACACCTGAAATTCTTGCATTTATGAA...

CDS

Download CDS FASTA

558 bp · TkA01G528680|TK1151|CDS

ATGGCTTCATCTGGGGGAGAGGAAACACCTGAAATTCTTGCATTTATGAAGCTAGCATTAGAACAGGCAAAAATCGCATTTGAAAGCCTTGAGGTGCCTGTAGGATGTGTTATTGTTATGGATGGAAAAGTCATATCACATGGAAGAAATCGGACTAATGAAACAAGAAATGCTACAAGACATGCTGAAATGGAAGCTATTGATGTTTTGCTTAATGAGTGGAAAGAAAAGAAACATACAAAACATCAAGTTGCTGACAT...

Protein

Download Protein FASTA

185 aa · TkA01G528680|TK1151|PROTEIN

MASSGGEETPEILAFMKLALEQAKIAFESLEVPVGCVIVMDGKVISHGRNRTNETRNATRHAEMEAIDVLLNEWKEKKHTKHQVADMFSKCYLYVTCEPCIMCASALSFLGIKEVFYGCANDKFGGCGSILSLHTTTTTTSDIGRKSYKCTGGIMGEEAVNLFRNFYELGNPNAPKPHRQLVQQP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G528680`
TK1151 ID	TkA01G528680
OH-1004 ID	LXL04_001526
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G528680

Location Chr01:132700757-132703091 (-)

Description Similar to TAD2: tRNA-specific adenosine deaminase TAD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48175`	Involved in RNA editing.	Identification of enzymes for adenosine-to-inosine editing and discovery of cytidine-to-uridine editing in nucleus-encoded transfer RNAs of Arabidopsis.2014 · DOI: 10.1104/pp.114.250498

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002100 tRNA wobble adenosine to inosine editing Biological Process

GO:0006400 tRNA modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008251 tRNA-specific adenosine deaminase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0052717 tRNA-specific adenosine-34 deaminase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48175

bta:615418

mmu:66757

xtr:780017

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.629

Rank 1 · TkA01G528680 · TK1151

Nucleus0.486

Rank 2 · TkA01G528680 · TK1151

Mitochondrion0.125

Rank 3 · TkA01G528680 · TK1151

Cell membrane0.066

Rank 4 · TkA01G528680 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA01G528680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383dCMP_cyt_deam_114-119 aa

PF14437MafB19-deam14-138 aa

PF14439Bd3614-deam37-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G528680	`PF00383`	dCMP_cyt_deam_1	14	119	1.5e-22	80.1
TkA01G528680	`PF14437`	MafB19-deam	14	138	4.9e-17	62.8
TkA01G528680	`PF14439`	Bd3614-deam	37	110	1.1e-05	26.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6IDB6`	Arabidopsis thaliana	sp\|Q6IDB6\|TAD2_ARATH tRNA-specific adenosine deaminase TAD2	71.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card