TkA01G521280 | RubberDandelionOmics

Gene overview

TkA01G521280

Reference: TK1151 Chr: Chr01 Coordinates: 130728285-130728701 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA01G521280|TK1151|cDNA

ATGAGGCGTGTGTTTGACAAGTTTGATCGTGATAAAGATGGAAAGATATCGAGGAGCGAATACAAAGCTATACTTAGGGCACTAAAACAAGGGGGTACAGATAGAGACATACAAAAGATATTTGAGGTGGCGGATTTGGACGGTGATGGGTTTGTTAGTTTCAAGGAGTTTATGGAGGTGCAAAAGAAAGGCGGTGGTGTGAAGGCCGTGGATGTGCAAAGTGCATTTCGAACGTTTGATGTGGATGGAGATGGGAAGAT...

CDS

Download CDS FASTA

417 bp · TkA01G521280|TK1151|CDS

ATGAGGCGTGTGTTTGACAAGTTTGATCGTGATAAAGATGGAAAGATATCGAGGAGCGAATACAAAGCTATACTTAGGGCACTAAAACAAGGGGGTACAGATAGAGACATACAAAAGATATTTGAGGTGGCGGATTTGGACGGTGATGGGTTTGTTAGTTTCAAGGAGTTTATGGAGGTGCAAAAGAAAGGCGGTGGTGTGAAGGCCGTGGATGTGCAAAGTGCATTTCGAACGTTTGATGTGGATGGAGATGGGAAGAT...

Protein

Download Protein FASTA

138 aa · TkA01G521280|TK1151|PROTEIN

MRRVFDKFDRDKDGKISRSEYKAILRALKQGGTDRDIQKIFEVADLDGDGFVSFKEFMEVQKKGGGVKAVDVQSAFRTFDVDGDGKISVEEVFELMKRLGERCSLQDCQKMVRAVDSNQDGVIDMDEFMTMMTQNTNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G521280`
TK1151 ID	TkA01G521280
OH-1004 ID	LXL04_001627
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 75.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G521280

Location Chr01:130728285-130728701 (-)

Description Similar to CML30: Calmodulin-like protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g15680`	Potential calcium sensor.	No verified direct reference in this release
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release
`At2g36180`	Potential calcium sensor.	No verified direct reference in this release
`At5g17470`	Potential calcium sensor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001627 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G15680

dosa:Os01g0949500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.411

Rank 1 · TkA01G521280 · TK1151

Peroxisome0.212

Rank 2 · TkA01G521280 · TK1151

Nucleus0.169

Rank 3 · TkA01G521280 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA01G521280 · TK1151

Mitochondrion0.098

Rank 5 · TkA01G521280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_71-60 aa

PF13405EF-hand_61-28 aa

PF25825SAPC2_N1-20 aa

PF00036EF-hand_12-28 aa

PF13202EF-hand_52-24 aa

PF30624EF_SSP1202-21 aa

PF10869DUF26662-43 aa

PF30347RSA-1_C2-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G521280	`PF13499`	EF-hand_7	1	60	3.4e-30	104.9
TkA01G521280	`PF13405`	EF-hand_6	1	28	2.7e-28	95.6
TkA01G521280	`PF25825`	SAPC2_N	1	20	0.17	12.5
TkA01G521280	`PF00036`	EF-hand_1	2	28	3e-33	111.6
TkA01G521280	`PF13202`	EF-hand_5	2	24	3.4e-29	99.7
TkA01G521280	`PF30624`	EF_SSP120	2	21	1.9e-08	35.6
TkA01G521280	`PF10869`	DUF2666	2	43	0.031	15.3
TkA01G521280	`PF30347`	RSA-1_C	2	57	0.052	14.5
TkA01G521280	`PF14658`	EF-hand_9	3	60	1.5e-11	45.2
TkA01G521280	`PF23564`	EF-hand_FSTL1	3	26	9.6e-11	42.8
TkA01G521280	`PF12763`	EH	3	58	9.7e-07	29.4
TkA01G521280	`PF24548`	EF_EFCAB10_C	3	28	1.1e-05	25.7
TkA01G521280	`PF25578`	EF-hand_STIM1	3	42	0.00021	22.0
TkA01G521280	`PF21008`	AIF-1	4	60	1.2e-05	26.3
TkA01G521280	`PF08976`	EF-hand_11	4	58	0.026	16.1
TkA01G521280	`PF25530`	EF-hand_SWAP70_N	4	59	0.042	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQE6`	Arabidopsis thaliana	sp\|Q9ZQE6\|CML30_ARATH Calmodulin-like protein 30	40.700%	Swiss-Prot	Medium
`Q9LE22`	Arabidopsis thaliana	sp\|Q9LE22\|CML27_ARATH Probable calcium-binding protein CML27	27.900%	Swiss-Prot	Low
`Q9SJN6`	Arabidopsis thaliana	sp\|Q9SJN6\|CML31_ARATH Probable calcium-binding protein CML31	30.700%	Swiss-Prot	Medium
`Q9LF55`	Arabidopsis thaliana	sp\|Q9LF55\|CML32_ARATH Probable calcium-binding protein CML32	33.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card