TkA01G519360 | RubberDandelionOmics

Gene overview

TkA01G519360

Reference: TK1151 Chr: Chr01 Coordinates: 130203185-130204309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA01G519360|TK1151|cDNA

ATGGCTACTTTGAGCTCTATAAGTGGGCTTGCGTCTGCTATGGGACCCGCACTTGACAAGTCAAGCAAGATGTTTCAGCATGTAAATGGAATGACACAGATTAAGCAAGCTACATATGGCAATGTTGACATGAATTTTGTGCTAGGAGTGGGAGGTTACGATCTTGACAGAATTGATTATGAAATTCCATCAGATGGTTCTCATTGCCATGAGCATGAACATGGACATGAGTTTCTTGGATTTCAGGATACACTTTATTC...

CDS

Download CDS FASTA

504 bp · TkA01G519360|TK1151|CDS

ATGGCTACTTTGAGCTCTATAAGTGGGCTTGCGTCTGCTATGGGACCCGCACTTGACAAGTCAAGCAAGATGTTTCAGCATGTAAATGGAATGACACAGATTAAGCAAGCTACATATGGCAATGTTGACATGAATTTTGTGCTAGGAGTGGGAGGTTACGATCTTGACAGAATTGATTATGAAATTCCATCAGATGGTTCTCATTGCCATGAGCATGAACATGGACATGAGTTTCTTGGATTTCAGGATACACTTTATTC...

Protein

Download Protein FASTA

167 aa · TkA01G519360|TK1151|PROTEIN

MATLSSISGLASAMGPALDKSSKMFQHVNGMTQIKQATYGNVDMNFVLGVGGYDLDRIDYEIPSDGSHCHEHEHGHEFLGFQDTLYSHIGKLYYKDCYIEGSVDFIFCDSTALFEHCQVYCKAAGYVAAQSRTSAQEKIGFVFLKCVITGTYFFEAHAKHGLPLVVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519360`
TK1151 ID	TkA01G519360
OH-1004 ID	LXL04_034600
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.200
Protein coverage (%)	TK1151 98.802 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G519360

Location Chr01:130203185-130204309 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29090`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g19730`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g47500`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g26810`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g09760`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.538

Rank 1 · TkA01G519360 · TK1151

Cytoplasm0.156

Rank 2 · TkA01G519360 · TK1151

Lysosome / Vacuole0.142

Rank 3 · TkA01G519360 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA01G519360 · TK1151

Nucleus0.057

Rank 5 · TkA01G519360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11603Sir120-29 aa

PF01095Pectinesterase77-152 aa

PF11603Sir1102-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G519360	`PF11603`	Sir1	20	29	0.13	13.5
TkA01G519360	`PF01095`	Pectinesterase	77	152	6.8e-19	68.4
TkA01G519360	`PF11603`	Sir1	102	120	0.13	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVQ0`	Arabidopsis thaliana	sp\|Q9LVQ0\|PME31_ARATH Pectinesterase 31	69.900%	Swiss-Prot	Low
`Q8VYZ3`	Arabidopsis thaliana	sp\|Q8VYZ3\|PME53_ARATH Probable pectinesterase 53	57.000%	Swiss-Prot	Low
`Q8LPF3`	Arabidopsis thaliana	sp\|Q8LPF3\|PME68_ARATH Probable pectinesterase 68	46.100%	Swiss-Prot	Low
`O04953`	Arabidopsis thaliana	sp\|O04953\|PME52_ARATH Putative pectinesterase 52	38.600%	Swiss-Prot	Low
`Q9LXD9`	Arabidopsis thaliana	sp\|Q9LXD9\|PME51_ARATH Probable pectinesterase/pectinesterase inhibitor 51	41.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card