Gene Card
Gene overview
cDNA / CDS / Protein Sequences
6640 bp · TkA01G518650|TK1151|cDNA
ATAACCCCGCCTCCCACGCACCCATGGGCATGGCCATGTCGGGGAAGGTTTAACAAGCCGGAAAGTCCAATTTTCAGTTTCAGATTTGATGGTAACGTAAACTTTTTCCTTCGTATTTTGACGGAAAACTCTTCACAAATGTCGTGGGAGCCGAAGGAGAAGTCGAGCAGCAGCATATTGACGGCAGCAACGGGTGGTAGGAGTTTTGTGGATTCCATTTAATGTCTACAAAAACGGAGAGGACAGAGAAGTCTATTTTG...
5808 bp · TkA01G518650|TK1151|CDS
ATGGAGGCATTAACGGAGCTTTGCGACTTGATCTCCCATAATCCTAATCTATATTCCGCCAAAATTGCCTGGATTTGCAAACGATGCCCTCCACCGGAGTCGCTCCTCTCCGGTTCTCCTCGGATTTCAAGGTTTCAACTCAACGCTGTTCTTGCAACGGCCAGATTCATCTCCAAATGCCCTAATTACGACGATCCAGGCCCTCGGAATACGGTTCTGGAGTTCATCCGCTCAATCCCATCGTCGTTTACCCAATCATT...
Protein
Download Protein FASTA1935 aa · TkA01G518650|TK1151|PROTEIN
MEALTELCDLISHNPNLYSAKIAWICKRCPPPESLLSGSPRISRFQLNAVLATARFISKCPNYDDPGPRNTVLEFIRSIPSSFTQSFWPKSFPNASIASFYNEFFGYVVKATELYKDFSTDVAGFMGGIVFSALNDNSSDSVISRAFLSALSESFPQIIPADANKLVTSLLDSFASYNSPASSSSTNEESKGVTNFNEESIEQLEKQEIAFQLIERILDKVEIDTQLLERVRLITKDQLRLMTAFLKIRKHDWTEQGASL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G518650 |
|---|---|
| TK1151 ID | TkA01G518650 |
| OH-1004 ID | LXL04_015971 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 39.800 |
| Protein coverage (%) | TK1151 13.282 / OH-1004 27.760Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G518650 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:130013000-130022382 (+) | |||||||||
| Description | Similar to PI4KB1: Phosphatidylinositol 4-kinase beta 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006661 phosphatidylinositol biosynthetic process Biological Process GO:0009860 pollen tube growth Biological Process GO:0043327 chemotaxis to cAMP Biological Process GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process GO:0048015 phosphatidylinositol-mediated signaling Biological Process GO:0048768 root hair cell tip growth Biological Process GO:0140459 response to Gram-positive bacterium Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G09350 ath:AT5G64070 ddi:DDB_G0288485 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19274PI4K_N211-1376 aaPF31230TIGD5_C783-795 aaPF00613PI3Ka1432-1552 aaPF21245PI4KB-PIK1_PIK1481-1540 aaPF00454PI3_PI4_kinase1675-1882 aaPF03109ABC11786-1813 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G518650 | PF19274 | PI4K_N | 211 | 1376 | 2054.0 | |
| TkA01G518650 | PF31230 | TIGD5_C | 783 | 795 | 0.071 | 13.4 |
| TkA01G518650 | PF00613 | PI3Ka | 1432 | 1552 | 1.3e-20 | 74.4 |
| TkA01G518650 | PF21245 | PI4KB-PIK1_PIK | 1481 | 1540 | 0.00064 | 20.5 |
| TkA01G518650 | PF00454 | PI3_PI4_kinase | 1675 | 1882 | 8.1e-37 | 128.1 |
| TkA01G518650 | PF03109 | ABC1 | 1786 | 1813 | 0.046 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.