TkA01G518330 | RubberDandelionOmics

Gene overview

TkA01G518330

Reference: TK1151 Chr: Chr01 Coordinates: 129921082-129922223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

721 bp · TkA01G518330|TK1151|cDNA

TAAAAGCCCTAGATATTGAATCCAACAACCAAAAAGAAAGTGAAACTGTGAAAGAACATTCGGATTGGCGTTTATGTTGGGAGTTCGTTTGTTATGATGACACGGGAGTTTTTTAGGTCAAGGAAGAACCCTAGAAGGAGAAGATGCTAGGCGAGGAAGCCAAGGTGTTGCTAGGCTTTCTTCCTAATTCCACACCTTCATCGTCACAGGTCAAAGCAGCCTACAAGAAAAAAGCATTGGAAACTCATCCAGATCGTTTC...

CDS

Download CDS FASTA

405 bp · TkA01G518330|TK1151|CDS

ATGCTAGGCGAGGAAGCCAAGGTGTTGCTAGGCTTTCTTCCTAATTCCACACCTTCATCGTCACAGGTCAAAGCAGCCTACAAGAAAAAAGCATTGGAAACTCATCCAGATCGTTTCCCCCTTTCCCAAAGATCTCTCGCCGAATCCAATTTCAAACTGATTTCGGAAGCTTACACATGCTTACAGTCTGGTGTGAGAAGAGAAGTTCCAACTGCAGGTACATATTCATGGGTGGTGAGAACTGGAGTCCCAAGGGCTCA...

Protein

Download Protein FASTA

134 aa · TkA01G518330|TK1151|PROTEIN

MLGEEAKVLLGFLPNSTPSSSQVKAAYKKKALETHPDRFPLSQRSLAESNFKLISEAYTCLQSGVRREVPTAGTYSWVVRTGVPRAHGGSRNHGLIGIPFLLIVFGTVALGGSSATRAYRRQKEAYPSHNPFLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G518330`
TK1151 ID	TkA01G518330
OH-1004 ID	LXL04_001697
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G518330`
Location	Chr01:129921082-129922223 (-)
Description	Similar to SPCC63.13: Uncharacterized J domain-containing protein C63.13 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001697` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006986 response to unfolded protein Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0016558 protein import into peroxisome matrix Biological Process GO:0030308 negative regulation of cell growth Biological Process GO:0031396 regulation of protein ubiquitination Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0032091 negative regulation of protein binding Biological Process GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0032781 positive regulation of ATP-dependent activity Biological Process GO:0032880 regulation of protein localization Biological Process GO:0036503 ERAD pathway Biological Process
KEGG gene cross-reference	hsa:3300 mmu:56812 sce:YER048C spo:2539451 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.350

Rank 1 · TkA01G518330 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA01G518330 · TK1151

Nucleus0.132

Rank 3 · TkA01G518330 · TK1151

Cytoplasm0.104

Rank 4 · TkA01G518330 · TK1151

Peroxisome0.093

Rank 5 · TkA01G518330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ18-68 aa

PF28419WetA_C20-34 aa

PF28419WetA_C107-126 aa

PF00226DnaJ117-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G518330	`PF00226`	DnaJ	18	68	2e-10	41.3
TkA01G518330	`PF28419`	WetA_C	20	34	0.094	13.5
TkA01G518330	`PF28419`	WetA_C	107	126	0.094	13.5
TkA01G518330	`PF00226`	DnaJ	117	125	2e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card