TkA01G518090 | RubberDandelionOmics

Gene overview

TkA01G518090

Reference: TK1151 Chr: Chr01 Coordinates: 129857234-129860849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1682 bp · TkA01G518090|TK1151|cDNA

ATTACTAAAATAAAAAAGGACACACATTAACCGACAGTCACAAAATTCTTTTATCTTGTCATTAATTAACAGTACGTGTGATTTCATCTTCTTCATCCGCCACCACCGTCCCACCGGAGTAGAGGACAAATATCCAACTAGTCTCTAGGCCCCACCCCTCTGTATTCTAAATTTCTACTCGATTAACTCCTTTCACACCTCCCCTTTCTTTATCAGCAATCCATGGCGAGTTCTCTCATGTTCTTCATCATTTGCAGTTT...

CDS

Download CDS FASTA

1101 bp · TkA01G518090|TK1151|CDS

ATGACCGCTGTTGACCAAAGTCTTGTGCCCCTTTGTCTTCCTGCCATGCAAAATGTCCAAAACGCCCTTAATGCAGCATCATTGGGTGGGAAAATAAAGGTATCAACGGTGCACTCGATGGCGGTGTTGGGAGCCTCCGATCCGCCTTCTTCGGCTGTTTTCAATTCAGGGTTCAGCGACACCATGAGAGCACTGTTGAAGTTCCACAGTGCAAATGGGTCGCCTTTCATGATCAACCCTTACCCATTCTTTGCTTACCA...

Protein

Download Protein FASTA

366 aa · TkA01G518090|TK1151|PROTEIN

MTAVDQSLVPLCLPAMQNVQNALNAASLGGKIKVSTVHSMAVLGASDPPSSAVFNSGFSDTMRALLKFHSANGSPFMINPYPFFAYQSDPRPETLAFCLFQPNSGRVDSGNGIKYMNMFDAQVDAVRSALNAMGFKDVEIVVAETGWAYKGDPNEIGTSVDNAKAYNGNLINHLRSKVGTPLMPGKSIDSYIFALYDENLKPGPGSERGLGFLSPISPWLMTLVFPRPIIEYFFGGQTPATPTSPATPTTPATSSEGWCV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G518090`
TK1151 ID	TkA01G518090
OH-1004 ID	LXL04_021582
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.400
Protein coverage (%)	TK1151 90.984 / OH-1004 70.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G518090

Location Chr01:129857234-129860849 (+)

Description Similar to GLC1: Glucan endo-1,3-beta-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At1g32860`	Glucan endo-1,3-beta-glucosidase 11.	No verified direct reference in this release
`At2g27500`	Glucan endo-1,3-beta-glucosidase 14.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021582 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G32860

ath:AT2G01630

ath:AT4G34480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.462

Rank 1 · TkA01G518090 · TK1151

Cytoplasm0.150

Rank 2 · TkA01G518090 · TK1151

Lysosome / Vacuole0.122

Rank 3 · TkA01G518090 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA01G518090 · TK1151

Cell membrane0.103

Rank 5 · TkA01G518090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1711-215 aa

PF29664BtgE-BtgC_glyc-hydro117-202 aa

PF07983X8258-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G518090	`PF00332`	Glyco_hydro_17	11	215	9.2e-47	160.9
TkA01G518090	`PF29664`	BtgE-BtgC_glyc-hydro	117	202	5.9e-05	23.1
TkA01G518090	`PF07983`	X8	258	328	1.6e-20	74.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M069`	Arabidopsis thaliana	sp\|Q9M069\|E137_ARATH Glucan endo-1,3-beta-glucosidase 7	63.700%	Swiss-Prot	High
`Q8L868`	Arabidopsis thaliana	sp\|Q8L868\|E1311_ARATH Glucan endo-1,3-beta-glucosidase 11	49.800%	Swiss-Prot	Medium
`Q9ZQG9`	Arabidopsis thaliana	sp\|Q9ZQG9\|E1314_ARATH Glucan endo-1,3-beta-glucosidase 14	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card