TkA01G518070 | RubberDandelionOmics

Gene overview

TkA01G518070

Reference: TK1151 Chr: Chr01 Coordinates: 129848406-129851131 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1586 bp · TkA01G518070|TK1151|cDNA

GATAATGATATTTTTGATAATAATCATCTTGAAAAGTACATTCAAGTATTCAAGTAGCCATTTGTCATTCCCTTCTATTCTACGCATTCTTGATTCCCTTATCCACTGCCTCAGTGGCTCTCTCGTAATAAATTCAAATATCAAGCCCAATTCACTACAAGTAGTCACTTGACTCTTGCCACGCTTTAACTTTGTCATTACTGATTACTGTCGGTTTGAATCACTTTGAATCACTTCTCCTTCTACACGCCATATTCTTT...

CDS

Download CDS FASTA

462 bp · TkA01G518070|TK1151|CDS

ATGAAGATTGCCATCGGGACTGCAAACGGATTGGCGTATTTACACGAAGGGTTGGAACCAAAAGTTGTACACCGCGATGTTAAATCAAGCAATATACTTCTGGATAAAAATTGGAACGCAAAAGTAGCTGATTTTGGACTTTCCAAGTTACTGGATTCCGAGAAAAGCTATGTGACTACACGAGTAATGGGGACATTTGGGATATGTATCCCTGACTATGCAAGCACAGGGATGCTTAATGAAGGCAGTGACGTTTACAG...

Protein

Download Protein FASTA

153 aa · TkA01G518070|TK1151|PROTEIN

MKIAIGTANGLAYLHEGLEPKVVHRDVKSSNILLDKNWNAKVADFGLSKLLDSEKSYVTTRVMGTFGICIPDYASTGMLNEGSDVYSFGILLMEIVTGRSPVDYSRPPGEMNVVEWFKGMVGSRRGPSPRDPKINLRPSPRALKRHCWYAFDV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G518070`
TK1151 ID	TkA01G518070
OH-1004 ID	LXL04_001702
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 94.771 / OH-1004 29.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G518070

Location Chr01:129848406-129851131 (+)

Description Similar to At4g34500: Probable receptor-like serine/threonine-protein kinase At4g34500

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34500`	Probable receptor-like serine/threonine-protein kinase At4g34500.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release
`At2g42960`	Probable receptor-like protein kinase At2g42960.	No verified direct reference in this release
`At5g18500`	Probable receptor-like protein kinase At5g18500.	No verified direct reference in this release
`At3g17420`	Probable receptor-like protein kinase At3g17420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001702 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009514 glyoxysome Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01540

ath:AT2G42960

ath:AT3G17420

ath:AT4G34500

ath:AT5G18500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · TkA01G518070 · TK1151

Nucleus0.282

Rank 2 · TkA01G518070 · TK1151

Cell membrane0.216

Rank 3 · TkA01G518070 · TK1151

Endoplasmic reticulum0.088

Rank 4 · TkA01G518070 · TK1151

Golgi apparatus0.037

Rank 5 · TkA01G518070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-104 aa

PF00069Pkinase3-105 aa

PF03109ABC112-56 aa

PF01636APH14-47 aa

PF12330Haspin_kinase24-59 aa

PF01636APH85-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G518070	`PF07714`	PK_Tyr_Ser-Thr	2	104	3.6e-21	76.4
TkA01G518070	`PF00069`	Pkinase	3	105	4.9e-22	79.3
TkA01G518070	`PF03109`	ABC1	12	56	0.0026	17.7
TkA01G518070	`PF01636`	APH	14	47	0.21	12.1
TkA01G518070	`PF12330`	Haspin_kinase	24	59	0.18	11.5
TkA01G518070	`PF01636`	APH	85	103	0.21	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKZ9`	Arabidopsis thaliana	sp\|Q6NKZ9\|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500	83.400%	Swiss-Prot	High
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	73.100%	Swiss-Prot	High
`Q9SJG2`	Arabidopsis thaliana	sp\|Q9SJG2\|Y2296_ARATH Probable receptor-like protein kinase At2g42960	64.800%	Swiss-Prot	High
`Q8LEB6`	Arabidopsis thaliana	sp\|Q8LEB6\|Y5185_ARATH Probable receptor-like protein kinase At5g18500	62.100%	Swiss-Prot	High
`Q9LRP3`	Arabidopsis thaliana	sp\|Q9LRP3\|Y3174_ARATH Probable receptor-like protein kinase At3g17420	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card