TkA01G516760 | RubberDandelionOmics

Gene overview

TkA01G516760

Reference: TK1151 Chr: Chr01 Coordinates: 129555036-129557421 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1324 bp · TkA01G516760|TK1151|cDNA

GCGGCTTATATCCACCCACTACCAATTAATTTAATCATCAGAAGGGTGCGTGACTCACAACTTGCAAATCATAAATAACACAATTTCACATTTGCTTCTTAGAGATTCAAGAATTAGAAAAAATGGGAAATGTGTTTCTCGTTCTAACACCCGTGATTCACGGAATCGTAAAGCTAGCCGGATTAACACCACAAACCATAGAAATAGAGCCGGGGACCATTATGAAAGTATGGGTTCCAAAAGAAATCGTCACCAAAGAT...

CDS

Download CDS FASTA

930 bp · TkA01G516760|TK1151|CDS

ATGGGAAATGTGTTTCTCGTTCTAACACCCGTGATTCACGGAATCGTAAAGCTAGCCGGATTAACACCACAAACCATAGAAATAGAGCCGGGGACCATTATGAAAGTATGGGTTCCAAAAGAAATCGTCACCAAAGATGACGGCAAAATCGTTTACGTACCACCCACTAAACCCGCAGTACTCCTCCTCCACTCTTTCGCCATGGACGGTATCTTCACATGGTTCTTTCAAGTTTTGGCATTGACACATGAATACTCGGT...

Protein

Download Protein FASTA

309 aa · TkA01G516760|TK1151|PROTEIN

MGNVFLVLTPVIHGIVKLAGLTPQTIEIEPGTIMKVWVPKEIVTKDDGKIVYVPPTKPAVLLLHSFAMDGIFTWFFQVLALTHEYSVYVPDFLFFGGSITDRNERSASFQAEFVAKGSKKLRVEKVTLVGLSYGGMVGFKMAKLYPELVKSMVISATVIELTESISLDSYKRLGLSSWSDLLMPTTIEGLKRMFSVGFHNLPWLPDFIYGDILETMFSNRKERNELLEDLVVLNKDAPSNTNYSQAIHMLWGDDDKIFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G516760`
TK1151 ID	TkA01G516760
OH-1004 ID	LXL04_001712
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G516760`
Location	Chr01:129555036-129557421 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001712` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0046464 acylglycerol catabolic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	mbo:BQ2027_MB2734 mtc:MT2788 mtu:Rv2715 mtv:RVBD_2715 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.505

Rank 1 · TkA01G516760 · TK1151

Lysosome / Vacuole0.184

Rank 2 · TkA01G516760 · TK1151

Cytoplasm0.160

Rank 3 · TkA01G516760 · TK1151

Cell membrane0.114

Rank 4 · TkA01G516760 · TK1151

Golgi apparatus0.102

Rank 5 · TkA01G516760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561Abhydrolase_158-168 aa

PF12697Abhydrolase_660-291 aa

PF12146Hydrolase_4112-200 aa

PF05577Peptidase_S28117-158 aa

PF08840BAAT_C120-160 aa

PF12695Abhydrolase_5122-184 aa

PF00756Esterase124-256 aa

PF12695Abhydrolase_5216-284 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G516760	`PF00561`	Abhydrolase_1	58	168	2.2e-17	64.2
TkA01G516760	`PF12697`	Abhydrolase_6	60	291	3.2e-10	41.7
TkA01G516760	`PF12146`	Hydrolase_4	112	200	2.1e-05	24.7
TkA01G516760	`PF05577`	Peptidase_S28	117	158	0.11	12.0
TkA01G516760	`PF08840`	BAAT_C	120	160	0.29	11.9
TkA01G516760	`PF12695`	Abhydrolase_5	122	184	0.08	13.4
TkA01G516760	`PF00756`	Esterase	124	256	0.18	12.2
TkA01G516760	`PF12695`	Abhydrolase_5	216	284	0.08	13.4
TkA01G516760	`PF00561`	Abhydrolase_1	241	291	2.2e-17	64.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card