TkA01G512820 | RubberDandelionOmics

Gene overview

TkA01G512820

Reference: TK1151 Chr: Chr01 Coordinates: 128523935-128526456 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1592 bp · TkA01G512820|TK1151|cDNA

TTCTTTTCCCTCTACCATTAATACCATATCTATAGCCCGATATAAGACCAATAGTTTCTGTAAAAATTGTCACAGATGGGGTCGCTAGAGATGAAGTCAATTCTCGAGCCACATGAGCAGATCACGTCCACTTCAGTATCAACCGATAAAATTACGCTTCCTGTGAAACGAGTCTTGGATGATTGTGATAGAAAACCTCTGTTTTGTAGAGTGATAACCAGTATCAAGATTGCTTTATTCTCTGATAAGATTAATTTACT...

CDS

Download CDS FASTA

681 bp · TkA01G512820|TK1151|CDS

ATGTTGCTTGTTCTTGGATGCGCGTTTTTCTGCGGAGGAATTGTTCATCCTAAGAAGGAACAAGTATTCAACAAGTCAAATGCAGTGATGAGCTCGGGGTTGCTGTTAATGGCGGTCATGGGTTTATTATTTCCTGCTGTTCTTCACTTCACACACACCGAATTGCATTTTGGGAAGTCGGAATTGGCGCTTTCGAGATTTAGTAGTTGTATAATGCTTATAGCATATGGTGCTTATCTGTTTTTCCAGTTGACTAGTCA...

Protein

Download Protein FASTA

226 aa · TkA01G512820|TK1151|PROTEIN

MLLVLGCAFFCGGIVHPKKEQVFNKSNAVMSSGLLLMAVMGLLFPAVLHFTHTELHFGKSELALSRFSSCIMLIAYGAYLFFQLTSQKNSYSPITEEAGVEDENSNDEESPDITKCESIIWLSILTLFISILSEYLVDTIEGASVALNIPIAFISVILLPIVGNAAEHASAIMFAVRDKLDISLGVAIGSSTQISMFAIPFCVVVGWISGRPLDLIFNFLKQQLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G512820`
TK1151 ID	TkA01G512820
OH-1004 ID	LXL04_032251
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.600
Protein coverage (%)	TK1151 96.460 / OH-1004 46.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G512820

Location Chr01:128523935-128526456 (-)

Description Similar to CAX2: Vacuolar cation/proton exchanger 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55730`	Vacuolar cation/proton exchanger (CAX).	No verified direct reference in this release
`At3g13320`	Vacuolar cation/proton exchanger (CAX).	Manganese specificity determinants in the Arabidopsis metal/H+ antiporter CAX2.2003 · DOI: 10.1074/jbc.m209952200
`At1g55720`	Vacuolar cation/proton exchanger (CAX).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0397400`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173
`Os04g0653200`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032251 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0030001 metal ion transport Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0005773 vacuole Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0015369 calcium:proton antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G55720

ath:AT1G55730

ath:AT3G13320

dosa:Os03g0397400

dosa:Os04g0653200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.411

Rank 1 · TkA01G512820 · TK1151

Cell membrane0.351

Rank 2 · TkA01G512820 · TK1151

Endoplasmic reticulum0.149

Rank 3 · TkA01G512820 · TK1151

Cytoplasm0.125

Rank 4 · TkA01G512820 · TK1151

Golgi apparatus0.096

Rank 5 · TkA01G512820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex1-84 aa

PF01699Na_Ca_ex118-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G512820	`PF01699`	Na_Ca_ex	1	84	2e-24	87.0
TkA01G512820	`PF01699`	Na_Ca_ex	118	219	2e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L783`	Arabidopsis thaliana	sp\|Q8L783\|CAX5_ARATH Vacuolar cation/proton exchanger 5	73.900%	Swiss-Prot	High
`Q39254`	Arabidopsis thaliana	sp\|Q39254\|CAX2_ARATH Vacuolar cation/proton exchanger 2	71.000%	Swiss-Prot	High
`Q9LFZ8`	Arabidopsis thaliana	sp\|Q9LFZ8\|CAX6_ARATH Putative vacuolar cation/proton exchanger 6	70.700%	Swiss-Prot	High
`Q5KQN0`	Oryza sativa subsp. japonica	sp\|Q5KQN0\|CAX2_ORYSJ Vacuolar cation/proton exchanger 2	70.600%	Swiss-Prot	High
`Q6K1C4`	Oryza sativa subsp. japonica	sp\|Q6K1C4\|CAX3_ORYSJ Vacuolar cation/proton exchanger 3	70.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card