TkA01G506900 | RubberDandelionOmics

Gene overview

TkA01G506900

Reference: TK1151 Chr: Chr01 Coordinates: 126948809-126950724 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1291 bp · TkA01G506900|TK1151|cDNA

AATTAACATAAACCCTACAAATCAAGACATCGGCCGACAGTTCACGACCTCCATAGCTGCTGCACGCCTGGTTCCGTTTAGGTGTTTCTTGAGTTACAAACTCATTACACTACCTATTCCAAAACCGTAAAGTTGCCATGGAATCCCTTTCAAGCGTTTGTTCAAATTCAATGTTTTCGTCACTTCAAAACCATAAAAATCCAACCTTATTTCCATCCATTACTTCTAATTCTCTTCCATTGAGTTCACAATTAAAATCG...

CDS

Download CDS FASTA

876 bp · TkA01G506900|TK1151|CDS

ATGGAATCCCTTTCAAGCGTTTGTTCAAATTCAATGTTTTCGTCACTTCAAAACCATAAAAATCCAACCTTATTTCCATCCATTACTTCTAATTCTCTTCCATTGAGTTCACAATTAAAATCGCAATACCGAGTATCCTTAAAACCCCATGTTTTTCCGCCGTTTCTAGTATCCAGGAAGAGAGTATTGAAGTGCATAAGTAGCAGAGAACGATTACAGACTACTTCCGATGAAGGCGAGAGTTTGAAGAACGATGTTCG...

Protein

Download Protein FASTA

291 aa · TkA01G506900|TK1151|PROTEIN

MESLSSVCSNSMFSSLQNHKNPTLFPSITSNSLPLSSQLKSQYRVSLKPHVFPPFLVSRKRVLKCISSRERLQTTSDEGESLKNDVRRKNLAVFVSGGGSNFRAVHQAILAGDVHGRFVVLVTNKHDCGGAQYARENNIPVIIYPRTKNEPEGLSSNDLVAALSTYSIDFILLAGYLKLIPSELIRAYPNSILNIHPSLLPAFGGKGYYGTKVHKAVIASGARYSGPTIHFVDEEYDTGRILAQRIVPVLVNDTAEELAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G506900`
TK1151 ID	TkA01G506900
OH-1004 ID	LXL04_004752
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	31.700
Protein coverage (%)	TK1151 41.237 / OH-1004 35.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G506900

Location Chr01:126948809-126950724 (+)

Description Similar to PURU1: Formyltetrahydrofolate deformylase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31220`	Phosphoribosylglycinamide formyltransferase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004752 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006189 'de novo' IMP biosynthetic process Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0009853 photorespiration Biological Process

GO:0046653 tetrahydrofolate metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008864 formyltetrahydrofolate deformylase activity Molecular Function

GO:0016740 transferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17360

ath:AT5G47435

bsu:BSU13110

mtu:Rv2964

mtv:RVBD_2964

syn:sll0070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · TkA01G506900 · TK1151

Mitochondrion0.045

Rank 2 · TkA01G506900 · TK1151

Nucleus0.026

Rank 3 · TkA01G506900 · TK1151

Cytoplasm0.021

Rank 4 · TkA01G506900 · TK1151

Peroxisome0.012

Rank 5 · TkA01G506900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00551Formyl_trans_N89-273 aa

PF24270HTH_Cmi2_C242-280 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G506900	`PF00551`	Formyl_trans_N	89	273	3.3e-54	184.1
TkA01G506900	`PF24270`	HTH_Cmi2_C	242	280	0.09	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P52422`	Arabidopsis thaliana	sp\|P52422\|PUR3_ARATH Phosphoribosylglycinamide formyltransferase, chloroplastic	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card